SecReT4
Protein ID: 206479953
T4SS name [ID]Tra_F [527]
Gene symbol-
Locus tagpBCA027
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]34456..35700 [-]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDB4EQG4
KEGG IDbcj:pBCA027
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 4.3e-44, Aligned region: 30..197
TraN [PF06986], Evalue: 4.3e-44, Aligned region: 290..358
Protein Sequence: 414 a.a.     [Download]
>gi|206479953|ref|YP_002235464.1| conjugal transfer mating pair stabilization protein TraN [Burkholderia cenocepacia J2315]
MSKRFLLRIVLLAAAALSSGAHIVHAEPMCQKISEVCVDGPSTKNISGVDVTRDCWRYTASYQCRSTDTS
SDCQALRDRGCGQVSTRCLSAAADGSCITQENTFLCKTTPDQVVNQTVCDKGAFCQNGVGCFDTSAPQDK
DFGQAVAMLEAAREAGVYGVSSKAVEIFKGYHETCSIKGVGGATLSNCCSSNDGGQTFVNYAMLAVGTGK
ALATGSHYMYDALYQNIDGTLMSKGIGAANSVTSLFSGGGFTPTFGMYGFTFSFSFSSGFTFVGFDPSSF
ALSVAIQLVQMWLKCNTAEQTLSLKRGQNLCVQTGTRCTKKVLGVCLEREQDHCCFNSILAKLINRQGRS
QLGMPMDQCGGFSADQITQLDFSRIDFSEFIASVAPKNPDQGGITGSVQKTVNDKVQSYYGNGQ
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c35700-34456 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGTCTAAGAGATTCCTTCTCCGGATTGTACTGCTCGCCGCGGCGGCTCTTTCCAGCGGCGCGCATATCG
TGCACGCCGAGCCCATGTGCCAGAAGATCAGTGAAGTGTGCGTCGACGGTCCGTCGACGAAGAACATTTC
AGGCGTCGACGTGACGCGTGATTGCTGGAGATACACCGCGAGCTACCAGTGCCGGTCGACCGATACGTCG
AGTGATTGTCAAGCGCTGCGGGATCGTGGCTGCGGTCAGGTGAGCACGCGGTGCCTGTCGGCAGCGGCCG
ACGGTTCTTGCATCACCCAGGAAAACACGTTCCTGTGCAAGACGACGCCCGATCAGGTCGTGAATCAGAC
CGTGTGCGACAAAGGTGCTTTCTGCCAAAACGGGGTGGGTTGTTTCGACACGAGCGCGCCACAAGACAAG
GATTTTGGGCAGGCCGTCGCGATGCTCGAGGCGGCTCGCGAGGCCGGTGTGTACGGCGTTAGTTCGAAGG
CAGTCGAGATCTTCAAGGGCTACCACGAGACCTGCAGCATCAAAGGTGTCGGTGGCGCCACGCTGTCGAA
TTGCTGCTCGTCGAACGATGGTGGGCAGACATTCGTCAACTACGCGATGCTCGCGGTCGGCACGGGTAAG
GCGTTGGCTACCGGGTCGCACTACATGTACGACGCTCTGTATCAGAACATCGACGGCACGCTGATGAGCA
AGGGTATTGGCGCGGCCAACAGCGTGACTTCGCTGTTTTCTGGCGGCGGCTTCACGCCGACCTTCGGTAT
GTACGGATTCACCTTCAGCTTCTCCTTCTCTTCCGGGTTCACGTTCGTCGGATTCGATCCGTCGAGTTTC
GCCCTGTCGGTCGCGATTCAGCTCGTACAGATGTGGCTGAAATGCAATACAGCCGAGCAGACGCTCTCGC
TGAAACGTGGCCAGAACCTCTGCGTCCAGACGGGCACGCGTTGCACGAAGAAGGTTCTCGGCGTCTGCCT
CGAGCGGGAGCAAGACCATTGCTGCTTCAACTCGATCCTCGCGAAGCTGATTAACCGGCAAGGCCGTTCG
CAACTCGGAATGCCGATGGACCAGTGCGGGGGATTCAGCGCAGACCAGATCACGCAGCTGGACTTCTCAC
GGATCGACTTTTCCGAATTCATCGCATCTGTCGCACCAAAGAACCCCGATCAGGGCGGTATCACCGGCAG
CGTTCAAAAGACCGTGAACGATAAGGTGCAGAGCTATTACGGGAACGGGCAATGA
 Primer design