SecReT4
Protein ID: 206479956
T4SS name [ID]Tra_F [527]
Gene symbol-
Locus tagpBCA030
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]37210..37911 [-]
Productputative conjugative transfer protein
Component typeTrbC_F
UniProt IDB4EQG7
KEGG IDbcj:pBCA030
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.6e-32, Aligned region: 104..212
Protein Sequence: 233 a.a.     [Download]
>gi|206479956|ref|YP_002235467.1| putative conjugative transfer protein [Burkholderia cenocepacia J2315]
MSHIAFFARPRNFVLAIIGLSASIIANAAGTVAAMPSDAQISAERARIERERKPMFADPNLGRSTAGNAF
PAIPTPPRAQLDPLAVAQRYAARAQSRKQEELLAFASLSMPAESLKRLVRDVARAGGAVVLRGFKDGSLK
TTVSAIQALGVDASAVQVNPNAFKQYRITAVPAIVLVKADRALDLDAEGCSLPANFAGVTGDVTVAYALR
EIGRRSSDYQPLADRILASLGEH
 
Nucleotide Sequence: 702 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c37911-37210 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
GTGAGCCATATCGCTTTCTTCGCCCGCCCGCGGAACTTCGTGCTCGCAATCATCGGGTTGAGCGCTTCCA
TCATCGCCAACGCCGCAGGCACCGTCGCCGCGATGCCGTCGGACGCGCAGATCTCTGCAGAACGGGCACG
CATCGAGCGGGAGCGCAAACCAATGTTCGCCGACCCGAATCTCGGCCGTTCGACAGCGGGTAACGCATTT
CCGGCCATACCGACGCCGCCGCGCGCGCAGCTCGATCCTCTCGCCGTCGCACAGCGCTACGCGGCGCGTG
CACAGTCGCGTAAGCAGGAGGAACTGCTCGCGTTCGCCAGCCTGTCCATGCCGGCCGAATCGCTCAAGCG
TCTGGTGCGCGACGTCGCGCGCGCCGGCGGGGCCGTCGTGCTGCGCGGCTTCAAGGATGGCTCGCTCAAG
ACCACTGTCAGTGCGATCCAGGCGCTCGGTGTCGACGCATCGGCTGTGCAGGTCAACCCGAATGCGTTCA
AGCAGTACCGCATCACGGCTGTGCCGGCGATCGTGCTCGTCAAGGCGGACCGTGCCCTCGATCTCGATGC
CGAAGGCTGTTCGCTGCCAGCGAATTTTGCAGGCGTGACGGGCGATGTGACCGTGGCGTATGCGCTTCGC
GAGATTGGTCGCCGCTCGTCGGATTACCAACCCCTCGCCGACAGAATCCTGGCGAGCCTGGGGGAGCACT
GA
 Primer design