SecReT4
Protein ID: 206479957
T4SS name [ID]Tra_F [527]
Gene symboltraU
Locus tagpBCA031
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]37908..38918 [-]
Productputative TraU conjugative transfer protein precursor
Component typeTraU_F
UniProt IDB4EQG8
KEGG IDbcj:pBCA031
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.7e-82, Aligned region: 32..331
Protein Sequence: 336 a.a.     [Download]
>gi|206479957|ref|YP_002235468.1| putative TraU conjugative transfer protein precursor [Burkholderia cenocepacia J2315]
MIRRLTTMICFAAALVLASGPALAGVSSNCNGKFANPITDICWSCIFPISLGGTPIITAGQEDGDNPGGL
LCACGPVLGIKIGFWEPVRRVDVTRVPYCFVSLGGIKIDPGIRTPEGEVRMQQDLTKQSSYQVHWYLDPI
LFWLEVLLDFACLETGNFDVAYLTEIDPTWNDDELTMLLNPETFLFGNPIAQAACAGDCVLSTAGFGSNA
LFWCAGCNGSIYPFNGHVQAHVSHVQASSLLVQRMTAKLHREGLLWGTMGGSGLCGSYPMPVMDKTQYKY
QMLYPIPETAKTNGRCCQPYGRTTAIWGAGKSYPYKGEDFAYMVFRKKNCCLGVLP
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c38918-37908 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGATTCGGCGCCTCACAACGATGATCTGCTTCGCCGCGGCGCTGGTGCTTGCTAGCGGTCCCGCATTGG
CTGGGGTGTCCTCGAACTGCAACGGCAAATTCGCGAACCCCATCACCGACATCTGCTGGAGCTGCATTTT
CCCGATCTCGCTCGGCGGGACACCGATCATCACCGCGGGCCAAGAGGACGGCGACAACCCTGGCGGCCTG
CTGTGCGCATGCGGTCCAGTACTCGGGATCAAGATCGGATTCTGGGAGCCCGTACGTCGTGTCGACGTGA
CGCGTGTGCCTTACTGCTTCGTCTCGCTCGGCGGCATCAAGATCGATCCGGGCATTCGTACGCCCGAGGG
TGAGGTGCGGATGCAGCAGGATCTGACAAAGCAATCGAGCTATCAGGTGCATTGGTACCTCGACCCAATC
CTGTTCTGGCTGGAGGTGCTGCTCGACTTCGCGTGTCTCGAGACGGGCAACTTCGATGTCGCGTACCTCA
CCGAAATCGATCCGACGTGGAACGACGACGAACTCACGATGTTGCTGAACCCCGAGACGTTCCTATTCGG
CAACCCCATAGCACAGGCTGCGTGCGCCGGCGACTGCGTGCTGTCGACCGCGGGCTTCGGCAGCAACGCG
CTCTTCTGGTGCGCGGGCTGCAACGGGTCGATCTATCCGTTCAACGGTCACGTGCAGGCACACGTCTCGC
ATGTTCAGGCGAGCTCACTGCTCGTGCAGCGGATGACCGCGAAGCTTCATCGGGAAGGACTCCTGTGGGG
AACGATGGGCGGCAGCGGGCTGTGCGGTAGCTACCCAATGCCCGTGATGGACAAGACCCAATACAAATAC
CAGATGCTGTACCCCATCCCGGAGACCGCCAAAACGAACGGGCGCTGTTGCCAGCCGTACGGGCGCACGA
CGGCTATTTGGGGCGCGGGCAAGAGCTATCCATACAAGGGCGAAGACTTCGCCTACATGGTGTTCCGCAA
AAAGAACTGCTGCCTGGGAGTCTTGCCGTGA
 Primer design