SecReT4
Protein ID: 206479958
T4SS name [ID]Tra_F [527]
Gene symboltraW
Locus tagpBCA032
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]38915..39553 [-]
Productputative TraW conjugative transfer protein precursor
Component typeTraW_F
UniProt IDB4EQG9
KEGG IDbcj:pBCA032
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 212 a.a.     [Download]
>gi|206479958|ref|YP_002235469.1| putative TraW conjugative transfer protein precursor [Burkholderia cenocepacia J2315]
MKFSKAVAAAMLVAGAIGDVHAGMLGAIGPAYPIAEPDAVAQIMAKLRVKERSGELKRLQEAATHRSLDS
AQNPAPVEGIRTATERSLRLIDPTVTYSKPVTTDDGRVVIPAGTKLNPLDLMPFTETLVFFDGRDREQAA
GVERMMAHAGARVKPVLIAGSWLDLTKQFKKQVYFDQHGVLSARFGISVVPAVIQQRGKQLELSVIPAKE
LQ
 
Nucleotide Sequence: 639 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c39553-38915 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGAAATTTTCTAAGGCGGTCGCCGCCGCTATGTTGGTCGCCGGTGCGATCGGCGACGTCCATGCCGGCA
TGCTTGGCGCAATCGGCCCCGCCTACCCGATCGCGGAGCCGGACGCCGTCGCACAGATCATGGCCAAGCT
GCGCGTGAAGGAACGGAGCGGGGAACTGAAGCGGCTGCAAGAAGCGGCGACCCATCGATCGCTCGATAGC
GCCCAGAACCCCGCACCGGTGGAGGGCATCCGCACGGCGACTGAGCGCAGCCTGCGACTCATCGATCCGA
CGGTCACCTATTCCAAGCCGGTCACGACGGATGACGGGCGTGTCGTTATCCCGGCCGGGACGAAGCTCAA
CCCGCTCGACTTGATGCCCTTCACAGAGACTCTCGTATTTTTCGATGGCCGCGACCGCGAACAAGCGGCC
GGCGTTGAGCGCATGATGGCGCACGCCGGCGCACGCGTGAAACCCGTCCTGATCGCTGGATCGTGGCTCG
ACCTCACGAAGCAGTTTAAGAAACAGGTCTACTTCGATCAGCATGGCGTGCTGTCCGCCCGCTTCGGCAT
TTCGGTTGTGCCGGCCGTGATTCAGCAGCGCGGCAAACAGCTCGAGCTGTCCGTGATTCCGGCGAAGGAG
CTGCAATGA
 Primer design