SecReT4
Protein ID: 206479968
T4SS name [ID]Tra_F [527]
Gene symboltraC
Locus tagpBCA041
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]44330..46936 [-]
Productputative TraC conjugative transfer protein
Component typeTraC_F
UniProt IDB4EQH9
KEGG IDbcj:pBCA041
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.1e-52, Aligned region: 48..291
AAA_10 [PF12846], Evalue: 1.1e-50, Aligned region: 490..779
Protein Sequence: 868 a.a.     [Download]
>gi|206479968|ref|YP_002235479.1| putative TraC conjugative transfer protein [Burkholderia cenocepacia J2315]
MAQIFDRSWLRQARDAAQSFWRDAVLGETPAHDDIEATLNSREGSSPSGLHHILKYDQYDDDTGLFYNDN
AVAFCFSVVQQTGADEDMVSQLTTLFTPIPAGTGVQWCLFGSTRVDAVLEHYEDLRHEAVEAGKVDPMFL
EIARRRTAYIRSMQGQSLWDSAPFLVKQTRLVFSVTRSGSHTDHTLVSEMADLKSTLMSSLRAGKLPARQ
MDADDLIAFLFPIFNPEYLFNGEPMPDLRYDPTRPIKEQITAFGHRARVRTTEILFGVPPGEDEPDTRVA
VRAFGVQRYPRSKHLWEMTGIVGSFTDTQLQYPCPYLICGGIFTLDRNVVDSRVQVRTARAQQNAESKMA
KFQPSLAAQSRDWKMVQVQLDAGGQMCELYHTLILFAPRQQINRYSQTAINLWDHVGFRIVPLRMMNLQA
LYASIPMTLTKGARGDLKRNRLMSQKTTVNAVDMSPVLGEWSGNGNPIMLFYGRRGAITPVDFYRNRQGN
YNLFASGVSGAGKTVTLNEVAFGYRSVGARCAIIDVGGGYENFVNMLDGAFIRFTLNSKICVNPFSWVGV
DEENTFEQELRMLKPLIGRMASPEAPLNALQYAFIEEAITVVWNRHNRASNPTLIAEYLMTEIKNEKGEI
ERIAYELGRQLRPFCEGGVYGRFFNGEANISFDNDLTCLELEELKDAPELRRVVLFALTSKIAHDMYMSP
RNLPKLCVVDEAWQLLGDDRETALFIEEGYRRARKYKGIFGLGTQSIEDAYKNDASKAAYNNADWKFILR
QDKQKLDNLIKDGLASFTPAVEKMIRSLQKEDGQFAEMIIDSPDGQMLVRHIPDPFALLVATSTGEDVEE
RNHLLKQGYTHFQALEVMLERRRARAAA
 
Nucleotide Sequence: 2607 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c46936-44330 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGGCACAAATCTTCGACCGATCGTGGCTCCGGCAGGCGCGAGACGCCGCGCAAAGCTTCTGGCGCGACG
CAGTTCTCGGCGAGACGCCGGCGCATGACGACATCGAGGCCACGCTGAATTCACGCGAGGGCTCGTCGCC
ATCCGGCCTTCATCACATCCTGAAGTACGACCAGTACGACGACGACACGGGCCTCTTCTACAACGACAAC
GCTGTGGCGTTCTGTTTCTCGGTCGTCCAGCAAACCGGTGCCGACGAGGACATGGTCAGCCAACTGACAA
CGCTGTTCACACCGATCCCTGCAGGTACAGGCGTCCAGTGGTGTCTTTTCGGCTCGACGCGCGTGGATGC
CGTGCTCGAACACTACGAGGACTTGCGCCACGAAGCGGTCGAGGCCGGGAAAGTAGATCCTATGTTCCTC
GAGATTGCCCGTCGGCGGACGGCATACATCCGTTCGATGCAAGGGCAATCGCTGTGGGACTCCGCTCCAT
TTCTCGTCAAGCAAACGCGGCTGGTGTTTTCGGTCACCCGCTCCGGATCGCACACTGATCACACGCTCGT
CAGCGAAATGGCAGACCTGAAGTCGACGCTCATGTCGTCACTGCGCGCTGGCAAGCTGCCGGCGCGCCAG
ATGGACGCTGACGATCTGATTGCTTTTCTGTTCCCAATCTTTAACCCGGAATACTTGTTCAACGGCGAGC
CGATGCCGGATCTTCGGTACGACCCGACACGCCCCATCAAGGAGCAGATCACGGCATTCGGGCACCGCGC
ACGCGTGCGCACTACCGAGATCCTGTTTGGCGTTCCTCCGGGCGAGGACGAGCCAGACACGCGAGTGGCC
GTTCGAGCGTTTGGCGTGCAACGCTATCCGAGGAGCAAGCATCTGTGGGAAATGACGGGCATTGTCGGCT
CGTTTACCGACACCCAGCTCCAATACCCGTGTCCGTACCTGATCTGCGGCGGGATCTTCACGCTTGACCG
CAACGTGGTCGACAGCCGCGTCCAGGTTCGCACGGCGCGGGCGCAACAGAACGCCGAATCGAAGATGGCA
AAGTTCCAGCCGAGTCTCGCTGCCCAGAGCCGTGACTGGAAGATGGTCCAGGTTCAGCTGGATGCAGGCG
GGCAGATGTGCGAGCTGTATCACACGTTGATCCTCTTTGCTCCGAGGCAGCAGATCAACCGATACAGCCA
GACGGCGATCAACCTCTGGGACCACGTCGGGTTTCGGATCGTCCCGCTTCGGATGATGAATCTGCAGGCG
CTGTACGCGAGCATCCCGATGACGCTGACGAAGGGCGCGCGCGGCGACCTGAAGCGCAACCGCCTCATGA
GCCAGAAGACCACCGTCAACGCTGTCGATATGTCGCCAGTGCTCGGCGAATGGAGCGGAAACGGCAATCC
GATCATGTTGTTCTATGGCCGACGGGGGGCGATCACTCCGGTCGACTTTTACCGGAACAGACAAGGCAAT
TACAACCTGTTCGCGTCTGGGGTTTCGGGTGCCGGAAAAACCGTGACGCTCAACGAGGTTGCATTCGGCT
ATCGAAGTGTCGGCGCGCGCTGCGCCATCATCGACGTCGGTGGCGGCTACGAAAACTTCGTGAACATGCT
GGACGGAGCGTTCATCCGCTTCACGCTGAACTCAAAAATCTGCGTGAACCCGTTCTCGTGGGTCGGCGTC
GACGAAGAGAACACCTTCGAGCAGGAACTTCGGATGCTCAAGCCGCTGATCGGCCGCATGGCGTCGCCGG
AGGCGCCGCTCAATGCGCTGCAGTACGCGTTCATTGAGGAGGCAATCACCGTCGTGTGGAATCGCCACAA
CCGGGCATCCAACCCGACGTTGATCGCCGAGTATCTGATGACCGAGATCAAGAACGAGAAGGGCGAAATC
GAACGTATCGCTTACGAGCTCGGCCGGCAACTTCGCCCGTTCTGTGAAGGCGGCGTCTACGGCCGCTTCT
TCAACGGCGAGGCGAACATCTCGTTCGACAACGACCTGACCTGCCTCGAGCTCGAAGAATTGAAGGATGC
GCCCGAGCTGCGCCGCGTGGTGCTGTTCGCACTGACCAGCAAGATCGCACACGACATGTATATGTCGCCG
CGAAACCTCCCCAAGCTGTGTGTAGTCGACGAAGCGTGGCAGCTCCTTGGCGACGATCGGGAGACAGCAC
TCTTCATCGAGGAAGGCTATCGGCGCGCGCGCAAGTACAAGGGCATCTTCGGACTGGGCACACAGTCGAT
CGAAGACGCATACAAGAACGACGCGTCAAAGGCTGCATACAACAACGCAGACTGGAAGTTCATTCTTCGC
CAGGACAAGCAGAAGCTCGACAACCTCATCAAGGACGGTCTTGCGAGCTTCACGCCGGCGGTCGAGAAGA
TGATCCGCTCGCTGCAGAAGGAAGATGGCCAGTTCGCGGAGATGATCATCGATTCGCCGGACGGCCAAAT
GTTGGTGCGGCATATCCCCGATCCGTTCGCACTGCTGGTGGCGACGTCCACCGGCGAGGACGTTGAGGAG
CGCAACCATCTTCTCAAACAAGGCTACACACACTTCCAGGCGCTCGAAGTGATGCTCGAACGCCGCCGCG
CGAGGGCCGCAGCATGA
 Primer design