SecReT4
Protein ID: 206479969
T4SS name [ID]Tra_F [527]
Gene symbol-
Locus tagpBCA042
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]46939..47466 [-]
Producthypothetical protein
Component typeTraV_F
UniProt IDB4EQI0
KEGG IDbcj:pBCA042
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 7.2e-15, Aligned region: 21..84
Protein Sequence: 175 a.a.     [Download]
>gi|206479969|ref|YP_002235480.1| hypothetical protein pBCA042 [Burkholderia cenocepacia J2315]
MSGVYANLRANNLPGQQISHGASLATTTKTPAPGSAVLSRPLFSGSPIRSAPRELRLWFAPWEDADGDLY
DQSYAYLVIDNGQWLIAHNQRRIRDLYRPAPGIAVRDGAGAPAAVPPPAAPAAATVPALDSGVPAPTGGL
SGMADEAMRQAAMAGDSLKQFAAGVRMPDASTVGR
 
Nucleotide Sequence: 528 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c47466-46939 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGTCCGGCGTGTACGCGAATCTCCGCGCGAACAACCTTCCTGGACAACAAATCAGCCACGGTGCATCGC
TGGCGACGACTACCAAGACGCCTGCGCCGGGCAGTGCTGTGCTGTCCCGTCCGTTGTTCTCTGGATCACC
GATCCGCAGCGCGCCGCGTGAGCTCCGCCTCTGGTTCGCGCCGTGGGAGGACGCCGACGGCGACCTCTAC
GACCAATCCTACGCGTATCTCGTGATTGATAACGGCCAGTGGTTAATCGCGCACAACCAACGCCGGATCC
GCGATCTGTATCGGCCCGCTCCCGGCATTGCCGTTCGCGACGGCGCGGGTGCGCCGGCGGCGGTGCCCCC
ACCCGCGGCGCCGGCGGCTGCAACTGTCCCGGCGCTCGATTCCGGCGTGCCCGCGCCAACCGGAGGCCTC
TCTGGCATGGCCGACGAAGCCATGCGCCAGGCCGCAATGGCAGGCGACTCGCTCAAGCAGTTCGCGGCCG
GCGTACGTATGCCGGACGCGTCGACCGTGGGGCGTTGA
 Primer design