SecReT4
Protein ID: 206479971
T4SS name [ID]Tra_F [527]
Gene symboltraB
Locus tagpBCA044
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]48385..49818 [-]
Productputative TraB conjugative transfer protein
Component typeTraB_F
UniProt IDB4EQI2
KEGG IDbcj:pBCA044
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.3e-36, Aligned region: 251..449
Protein Sequence: 477 a.a.     [Download]
>gi|206479971|ref|YP_002235482.1| putative TraB conjugative transfer protein [Burkholderia cenocepacia J2315]
MSDRNDSSAGAGTNDRIKSRQRVIMIVAMVLILAATGVGLFLSGDATPTAKPKPVVETIQPPGSISDRDA
WRGQSDAKLLDLEQRVQRVAAEQATAKAAIDKVASDVAGQKAAEASAAASAAAAASAAAAASAPSGTTSA
TTASPATLNKPLPVGTTGRGLGGKRVLTPPGDNTALNTPIGEGMPVSNELEIIDFDDSTDAGGVGAGPGG
TGGKLEVQGFPVDARARRYKMTTSTNGGAAGGAGGKGDVNLLPAGSFIPVAMLNGVDAPTGGQAQSDPLS
VDLEAIKPANLPNGKSLDVRGCRIVSSAWGDLSAERMMGRTQILSCIIAGHPIELEIKGKLIGEDGKEGV
RGRLVTKQGQVLANAILAGSLGGIGQAFQQSATVTSFGGGGVAQTIDGGQVGRAAIGGGVGTAGQMLAQY
YLKAADKLFPVIETDATRTIEVSITKGVYVDAATAALFDARSTFDRSRNRNRRTRDE
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c49818-48385 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGAGTGACCGAAACGATTCTTCCGCAGGGGCGGGCACGAACGATCGCATCAAATCTCGCCAACGCGTGA
TCATGATTGTGGCGATGGTGTTGATTCTTGCCGCGACGGGTGTCGGCTTGTTTCTAAGCGGAGACGCTAC
GCCGACGGCTAAGCCGAAGCCTGTTGTTGAAACGATTCAACCGCCGGGCTCAATAAGTGATCGTGACGCG
TGGCGGGGCCAATCCGATGCAAAGCTGCTCGACCTCGAGCAGCGAGTTCAACGCGTTGCTGCCGAACAGG
CAACCGCCAAGGCCGCAATCGACAAAGTTGCATCCGATGTCGCCGGCCAGAAAGCTGCCGAGGCCAGTGC
CGCGGCGAGTGCCGCCGCCGCCGCGTCTGCGGCAGCCGCTGCCTCTGCACCCTCGGGAACGACTTCCGCG
ACGACGGCGTCGCCGGCCACCCTCAACAAACCTCTCCCTGTTGGCACGACCGGTCGAGGTTTGGGTGGCA
AGCGCGTACTGACGCCGCCGGGCGACAACACCGCACTGAATACACCAATCGGCGAGGGCATGCCTGTGTC
GAATGAACTCGAGATCATCGATTTCGACGACAGCACAGACGCCGGTGGCGTCGGTGCCGGCCCCGGCGGC
ACCGGGGGGAAGCTCGAAGTTCAAGGATTTCCTGTCGACGCACGAGCGCGCCGCTACAAGATGACCACCT
CAACCAACGGCGGAGCCGCTGGTGGTGCCGGTGGCAAAGGCGACGTCAACTTGTTACCGGCCGGCTCCTT
CATCCCGGTTGCGATGCTCAACGGCGTCGACGCCCCGACTGGCGGGCAAGCGCAGAGTGATCCGCTTTCC
GTAGACCTTGAAGCGATCAAACCAGCGAATCTCCCGAACGGAAAGAGCCTCGATGTTCGGGGCTGTCGGA
TCGTATCAAGCGCGTGGGGTGATCTGTCTGCAGAACGCATGATGGGCCGCACACAAATCTTGTCGTGCAT
TATCGCCGGCCATCCGATTGAGCTCGAAATCAAGGGAAAGCTTATCGGCGAAGACGGTAAGGAAGGCGTT
CGTGGGCGACTTGTCACGAAGCAGGGCCAGGTTCTCGCGAATGCGATTCTGGCCGGCTCGCTTGGTGGCA
TCGGCCAGGCGTTCCAACAGTCCGCGACGGTGACGTCGTTCGGAGGCGGCGGCGTTGCGCAGACGATCGA
TGGCGGTCAGGTTGGCCGAGCCGCAATCGGCGGTGGTGTCGGAACTGCCGGCCAGATGCTCGCGCAGTAC
TACCTGAAGGCTGCTGACAAGCTCTTCCCTGTAATCGAAACGGACGCAACCCGAACGATCGAAGTCTCGA
TCACCAAGGGCGTGTACGTCGATGCGGCCACGGCCGCTCTCTTCGACGCGCGTTCGACGTTCGACCGTTC
CCGCAATCGCAATCGGAGAACCCGAGATGAATAA
 Primer design