SecReT4
Protein ID: 206479972
T4SS name [ID]Tra_F [527]
Gene symbol-
Locus tagpBCA045
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]49811..50557 [-]
Producthypothetical protein
Component typeTraK_F
UniProt IDB4EQI3
KEGG IDbcj:pBCA045
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 6.5e-31, Aligned region: 7..240
Protein Sequence: 248 a.a.     [Download]
>gi|206479972|ref|YP_002235483.1| hypothetical protein pBCA045 [Burkholderia cenocepacia J2315]
MFSNLRKWIAAATLFPIAAANVLPANAATAGASEPREYTVSATEQNRLEIAGRAIKKVVPSHKGALTYVK
DKGNGVFYFAFANGGDGMGTETLYVIDDQGATYQLLLQPRRVPSANIIVPAAGDAPGRSAAARTAATSSA
YQSAIKDLVYEMAAAQVDPSADPAASAVPVHQDVPLWKEARLTFDTKYVDDTFVGEQYTLTNVSSSDMVI
AEQELYRPGVVVVAVEQQTLAPGDSTRVYIVRERGRDE
 
Nucleotide Sequence: 747 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c50557-49811 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGTTCAGCAACTTGCGCAAGTGGATAGCCGCGGCAACGTTGTTCCCAATAGCGGCCGCTAACGTTCTGC
CCGCGAACGCAGCGACAGCGGGGGCGAGCGAGCCACGGGAATACACGGTTTCGGCGACCGAGCAGAACCG
TCTCGAGATCGCGGGGCGAGCCATCAAGAAGGTTGTGCCCAGTCACAAAGGCGCGCTGACCTATGTGAAG
GACAAGGGGAACGGGGTCTTCTATTTTGCCTTCGCAAATGGCGGGGACGGGATGGGAACCGAAACCCTGT
ACGTGATCGATGATCAAGGCGCTACCTACCAGTTGCTGTTGCAGCCGCGCCGAGTGCCGTCCGCGAACAT
CATCGTGCCGGCCGCCGGCGACGCTCCCGGTCGGAGCGCCGCAGCCCGCACGGCGGCGACTTCGTCGGCG
TACCAGAGCGCGATCAAGGATCTCGTGTACGAGATGGCCGCCGCTCAGGTCGATCCCAGTGCAGATCCTG
CAGCTTCAGCTGTTCCCGTGCATCAGGACGTGCCGCTGTGGAAGGAAGCACGCCTCACTTTCGATACGAA
GTACGTCGACGACACGTTCGTGGGTGAGCAATACACGCTCACGAACGTGTCCAGCAGCGACATGGTGATC
GCAGAACAAGAGCTGTATCGCCCAGGCGTCGTGGTCGTCGCCGTCGAGCAACAAACGCTCGCACCGGGCG
ACAGCACGCGCGTCTACATTGTCAGGGAGCGAGGCCGCGATGAGTGA
 Primer design