SecReT4
Protein ID: 206479973
T4SS name [ID]Tra_F [527]
Gene symboltraE
Locus tagpBCA046
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]50496..51086 [-]
Productputative TraE conjugative transfer protein
Component typeTraE_F
UniProt IDB4EQI4
KEGG IDbcj:pBCA046
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.1e-27, Aligned region: 11..170
Protein Sequence: 196 a.a.     [Download]
>gi|206479973|ref|YP_002235484.1| putative TraE conjugative transfer protein [Burkholderia cenocepacia J2315]
MTPDRAANERADLRSRVKFLKLCLVFTLGTIVLGLILVMFLVLRDPTRIVPPEIQHAYVIGSGTANGDYL
SDMSDYVLSLQATTTPETVDHNNAVILKMTDPAAYPVIKTMLDAAAIRIKRERITTIFVMRTKSIDRPNN
RVITTGTFKTYIGDKLVGEEDRSLLVAFNITLTGQTYVQQLAQVDSRGNVVPNSGR
 
Nucleotide Sequence: 591 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c51086-50496 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGACTCCCGACCGCGCCGCGAACGAGCGCGCCGACCTTCGCAGCCGCGTGAAATTCCTGAAGCTCTGCC
TCGTCTTCACCCTCGGCACGATCGTTCTCGGCCTCATCCTCGTGATGTTTCTCGTCCTTCGTGACCCTAC
CCGAATTGTGCCCCCAGAAATCCAGCACGCCTACGTAATTGGCTCGGGCACCGCGAATGGCGACTACCTC
AGCGACATGTCCGACTACGTGTTGAGCCTGCAGGCGACGACAACACCGGAAACGGTCGACCACAACAACG
CCGTGATTCTCAAGATGACCGACCCGGCAGCGTACCCGGTCATCAAGACGATGCTCGACGCGGCCGCGAT
CCGGATTAAGCGCGAGCGCATTACGACGATTTTTGTGATGCGTACCAAGAGCATTGACCGGCCCAACAAC
CGTGTGATTACGACCGGCACGTTCAAAACCTACATCGGCGACAAGCTCGTCGGCGAGGAAGATCGGAGCC
TTCTCGTCGCCTTCAACATCACCCTGACAGGACAGACCTATGTTCAGCAACTTGCGCAAGTGGATAGCCG
CGGCAACGTTGTTCCCAATAGCGGCCGCTAA
 Primer design