SecReT4
Protein ID: 206479974
T4SS name [ID]Tra_F [527]
Gene symbol-
Locus tagpBCA047
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]51093..51386 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDB4EQI5
KEGG IDbcj:pBCA047
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.5e-11, Aligned region: 9..95
Protein Sequence: 97 a.a.     [Download]
>gi|206479974|ref|YP_002235485.1| hypothetical protein pBCA047 [Burkholderia cenocepacia J2315]
MAAEDLSHAIPVTLDDGAKLLFWDWDVAMVVMTGITVGLGTGYPILGVALGLGLATIYSKFFKAGTHQGA
PFHLLGWMTGQPPMSDLPDSYLRDFQG
 
Nucleotide Sequence: 294 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c51386-51093 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGGCAGCCGAGGATCTCTCCCACGCCATCCCCGTCACGCTCGACGATGGCGCAAAGCTGTTGTTTTGGG
ATTGGGACGTTGCGATGGTCGTCATGACCGGCATCACTGTTGGCCTTGGCACCGGGTACCCGATCCTCGG
CGTCGCATTGGGGCTCGGTCTGGCCACCATCTATTCAAAGTTCTTTAAGGCAGGCACTCACCAGGGTGCT
CCCTTTCACCTGCTCGGTTGGATGACCGGGCAGCCGCCGATGTCGGACCTGCCCGACAGCTACCTGCGTG
ATTTCCAGGGGTAA
 Primer design