SecReT4
Protein ID: 206479977
T4SS name [ID]Tra_F [527]
Gene symbol-
Locus tagpBCA049
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]52162..52638 [-]
Productputative transglycosylase protein
Component typeOrf169_F
UniProt IDB4EQI8
KEGG IDbcj:pBCA049
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 158 a.a.     [Download]
>gi|206479977|ref|YP_002235488.1| putative transglycosylase protein [Burkholderia cenocepacia J2315]
MRYPAPTIRQIGLLIALAVLSCRVAHASCWEDAGSQYGIDPALLKAIAWKESRGWTGARGPILKDGNQAI
GLMQINTVHLPTLARVGIQRRDLFDACTSQRVGAWVLANCISQFGTTWKAVGCYNTGPASTNTAAQLRYV
RDVQRYYAAYKRAQQEAQ
 
Nucleotide Sequence: 477 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c52638-52162 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGCGTTATCCGGCTCCTACCATAAGACAAATAGGACTACTAATCGCACTCGCAGTCCTTTCTTGTCGAG
TTGCTCACGCGTCCTGCTGGGAAGACGCCGGCTCGCAATACGGCATCGATCCCGCTCTCCTCAAGGCAAT
CGCGTGGAAAGAATCTCGAGGGTGGACGGGAGCACGTGGCCCGATTTTGAAGGACGGGAATCAGGCCATC
GGCCTGATGCAGATCAACACCGTCCATCTTCCCACGCTCGCACGTGTCGGCATTCAACGTCGCGACCTGT
TCGACGCGTGCACCAGCCAGCGCGTCGGCGCCTGGGTGCTGGCCAACTGCATCTCGCAGTTCGGCACCAC
TTGGAAGGCTGTCGGTTGCTACAACACCGGCCCGGCCTCCACCAATACGGCGGCGCAGCTTCGGTATGTA
CGCGACGTCCAGCGCTACTACGCCGCCTACAAACGCGCCCAACAGGAGGCCCAATGA
 Primer design