SecReT4
Protein ID: 206479985
T4SS name [ID]Tra_F [527]
Gene symbol-
Locus tagpBCA057
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]59726..62545 [-]
Productputative conjugative transfer protein
Component typeTraI_F
UniProt IDB4EQJ6
KEGG IDbcj:pBCA057
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 7.9e-89, Aligned region: 8..295
AAA_30 [PF13604], Evalue: 7.1e-49, Aligned region: 428..610
AAA_19 [PF13245], Evalue: 7e-08, Aligned region: 434..497
Viral_helicase1 [PF01443], Evalue: 5.5e-07, Aligned region: 448..574
UvrD_C_2 [PF13538], Evalue: 4.9e-06, Aligned region: 784..899
AAA_22 [PF13401], Evalue: 7.3e-06, Aligned region: 443..565
PIF1 [PF05970], Evalue: 9.3e-06, Aligned region: 439..549
Protein Sequence: 939 a.a.     [Download]
>gi|206479985|ref|YP_002235496.1| putative conjugative transfer protein [Burkholderia cenocepacia J2315]
MLSLHNIASAAQTRNYFSKDNYYTQDENTKHSAWFGAGAARLGLAGQVQPAAFLNLLEGRVEEQQLGKWV
TDEETGERRQDHQPGIDITFSAPKSVSLMAEVAGDTAVRDAHEAAVQSALAYLEENVIRTRSTQNGVTSI
EHTGNMVAALFKHNTSRDLDPQTHTHAVVMNATLRADGKWRSIDNREIYQTQKLAGAIYNAELVSGLQQL
GYRLTNPDRHGNFEIQGISREQIEHFSQRRTAMKEKLGKRQLELDTASAADKERAALATRERKVDVDHEQ
LLADWQARALEQGIDLGALRATAAERKAEGIDPPTKLTGRQALAFAAAHLIEREAVVDKSDLVETAVVHG
TGRVSPQEVMKAFRQLEKNGDLVPLPDEKYTTRKMLESERWALDFVKQEKGNAPVVLEATKVQERIAEAE
RLQQFSYTFGQRDAIVLALTSKDRFVAIQGLAGTGKTTMLRTLNDIAAAEGYVVRGMAPTGAAAKVMVKE
TGIAAETVAMFQIKERQLQKDIEFAQQFAPDFKRKPEVWVVDESSFLAQRQMAQLHRLAEHAGAKVVYLG
DTLQLQGVEAGKPFELAQKDGIATAYMTDINRQKTDVMKEAVDIITGRNQLDAGTRLTDIELKRNGQSFQ
YLSQQGRVHETDEVVTSTVDKILAMSPEERARNITITPLNRDRVAINEGVRVGLQARGELSKNESTHEIL
VSKGFTRAQIKEAQYYERGDVVRFNRTYQQINADKGDYTRVIDVDHESGIVTLRKRDGSTLAWEPAKHNK
VEVYDPDLRQLAVGDVIRLTRNDETFKNGETARVVQLTGEHAVLQVDDRGVISHHSVNLETSQHWDHAYA
STVHAAQGASRNTTIFAINMPDNEDKKAQEREFQALAKVFGDRSYYVGVTRASHDISIVTNDIDLAQRAI
TGKLDKTTVIEAMNQEVREQTIQREQHEI
 
Nucleotide Sequence: 2820 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c62545-59726 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGTTGAGTCTGCACAACATCGCCAGCGCTGCCCAGACGCGAAACTATTTCTCGAAGGACAACTATTACA
CCCAGGACGAGAACACCAAGCACTCCGCCTGGTTCGGCGCCGGCGCGGCCCGCCTCGGTCTAGCCGGGCA
AGTTCAGCCGGCGGCGTTCCTCAACCTACTCGAGGGTCGAGTCGAGGAGCAGCAGCTCGGCAAATGGGTA
ACCGACGAGGAGACGGGCGAACGTCGTCAGGACCACCAGCCTGGCATTGACATCACCTTCTCCGCTCCAA
AGAGCGTGTCGCTGATGGCCGAAGTCGCCGGCGACACCGCCGTCAGGGACGCGCACGAAGCTGCCGTTCA
GTCCGCGCTAGCGTACCTGGAGGAGAACGTGATCCGCACGCGGTCGACCCAGAACGGCGTCACGTCGATC
GAACATACCGGCAACATGGTCGCCGCGCTCTTCAAACACAACACCAGCCGGGATCTCGACCCGCAGACCC
ACACGCATGCCGTTGTGATGAACGCGACGCTGCGCGCAGACGGTAAGTGGCGGTCGATCGACAACCGGGA
GATCTACCAGACTCAGAAGCTCGCGGGGGCCATCTACAACGCTGAACTCGTATCCGGCCTACAGCAGCTC
GGGTATCGCCTGACGAACCCGGATCGGCACGGCAACTTTGAAATCCAAGGAATCTCCCGCGAACAGATCG
AACATTTCAGTCAGCGGCGCACCGCAATGAAGGAAAAACTCGGTAAGCGCCAGCTCGAACTGGACACTGC
ATCCGCGGCCGACAAGGAGCGCGCGGCGCTCGCCACGCGCGAGCGCAAGGTGGACGTTGACCACGAGCAA
CTGCTCGCCGACTGGCAAGCGCGCGCTCTGGAACAGGGGATCGACCTCGGGGCACTGCGCGCGACAGCCG
CCGAGCGTAAGGCAGAGGGCATCGACCCACCGACGAAGCTAACGGGCCGTCAGGCGCTAGCATTCGCCGC
CGCCCACCTGATCGAGCGCGAAGCTGTGGTTGACAAGTCTGATCTGGTCGAGACGGCAGTGGTCCACGGT
ACCGGCCGCGTGTCGCCGCAGGAAGTGATGAAGGCTTTCCGGCAGCTCGAGAAGAACGGCGACCTGGTGC
CGCTGCCGGATGAGAAGTACACCACGCGGAAAATGCTCGAGAGCGAACGGTGGGCCCTCGACTTCGTCAA
GCAGGAAAAAGGCAATGCGCCCGTCGTGCTCGAGGCGACCAAAGTCCAGGAGCGTATAGCCGAAGCCGAG
CGTCTGCAGCAGTTCTCGTACACGTTCGGTCAACGCGATGCGATCGTGCTTGCGTTGACGTCCAAGGACC
GATTCGTAGCGATTCAGGGGCTAGCCGGTACGGGCAAGACGACGATGCTCCGCACGCTAAACGATATCGC
GGCCGCCGAGGGATATGTCGTGCGGGGCATGGCGCCGACCGGAGCGGCCGCGAAAGTGATGGTGAAAGAG
ACTGGCATTGCCGCCGAGACGGTCGCGATGTTCCAAATCAAGGAACGGCAACTACAGAAGGACATCGAGT
TCGCTCAACAGTTTGCCCCGGACTTCAAGCGGAAGCCGGAAGTATGGGTTGTCGACGAATCATCGTTCCT
TGCCCAACGACAGATGGCGCAACTGCATCGGCTCGCCGAGCATGCCGGTGCGAAGGTCGTCTACCTGGGG
GATACGCTTCAGCTGCAGGGGGTGGAAGCCGGCAAGCCGTTCGAACTCGCTCAGAAGGATGGTATCGCTA
CGGCGTATATGACCGACATCAACCGGCAAAAGACGGACGTGATGAAGGAAGCCGTGGACATCATCACCGG
CCGAAATCAGTTGGACGCCGGCACACGACTGACCGATATTGAACTGAAGCGCAACGGACAGTCGTTTCAA
TACCTGTCACAGCAAGGCAGGGTGCACGAGACGGATGAAGTCGTCACGTCGACCGTCGACAAGATCTTGG
CCATGAGCCCCGAGGAGCGAGCGCGTAACATCACGATTACGCCGCTGAACCGCGATCGTGTTGCGATTAA
TGAAGGTGTCCGTGTGGGCCTGCAAGCACGCGGAGAACTGTCAAAGAACGAATCTACACACGAGATCTTG
GTGTCGAAGGGCTTTACCCGTGCACAGATCAAGGAAGCACAGTACTACGAACGGGGTGATGTCGTTCGAT
TCAACCGCACCTACCAGCAAATCAATGCGGACAAGGGCGACTATACCCGGGTGATTGACGTCGATCACGA
ATCGGGCATCGTGACCCTTAGAAAACGAGACGGATCGACGCTCGCTTGGGAGCCGGCCAAGCACAACAAG
GTTGAAGTCTACGACCCCGACCTCCGGCAGTTGGCCGTTGGTGACGTGATTCGCCTCACTCGCAACGACG
AAACGTTCAAGAACGGCGAGACAGCGCGCGTCGTCCAGCTCACCGGAGAACACGCTGTCTTACAGGTCGA
TGATCGCGGTGTGATTAGCCACCACTCCGTCAATCTTGAGACAAGCCAACACTGGGATCATGCGTACGCA
TCGACCGTGCACGCGGCACAGGGCGCTTCCAGGAATACCACGATATTTGCGATCAACATGCCGGACAACG
AAGACAAGAAAGCGCAGGAGCGCGAATTTCAGGCACTTGCAAAGGTATTCGGTGACCGGAGCTATTACGT
TGGCGTCACCCGAGCGTCTCACGACATTTCCATTGTCACCAACGACATAGACCTGGCGCAGCGCGCGATT
ACCGGGAAGCTCGACAAGACGACAGTCATCGAGGCAATGAATCAGGAGGTTCGCGAGCAGACAATCCAGC
GCGAACAGCATGAAATTTGA
 Primer design