SecReT4
Protein ID: 206479986
T4SS name [ID]Tra_F [527]
Gene symboltraD
Locus tagpBCA059
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]63145..65064 [-]
Productputative TraD conjugative transfer protein
Component typeTraD_F
UniProt IDB4EQJ7
KEGG IDbcj:pBCA059
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2.2e-130, Aligned region: 171..552
TraG-D_C [PF12696], Evalue: 2.4e-22, Aligned region: 411..533
T4SS-DNA_transf [PF02534], Evalue: 4.6e-19, Aligned region: 360..549
AAA_10 [PF12846], Evalue: 3.8e-10, Aligned region: 394..492
Protein Sequence: 639 a.a.     [Download]
>gi|206479986|ref|YP_002235497.1| putative TraD conjugative transfer protein [Burkholderia cenocepacia J2315]
MTGKKPNGLFQDFSTGSEIWTHRVALVLVAIRNILLLSLFLGLAAGFIYAAFFVDRDIWRPAVANVIAHL
RSVVMMTAVPMEYEVNGQTVRLPVDQVVALTDPVWDVAYFFLRRFLIIVATVTACTCVSIAAYWYEFGRS
TMADKDLRGATLVNGKQLAKMIRQDDMESPYSIAGVPMLRNAETLHTLVVGAQGTGKSQQFFDRLRQVRA
RGKRAIVYDPSGEFAEEFFREGKDVMMNPFDDRSPNWNIKYEIEEEYHYDSMATALIPDPREADPFWSLA
GREVFRDVARTLHREGNLTNRNLYNSIAMSNLDAIYQLLRNTAGASYVDPKTERTGMSLKMTVQNQLSSF
RYLRDDGKPFSIRQWIYNESDSWMFISTREEMLEAIKPIMSLWIDIAIKAVLNLTPIHRERLHFSIDEVP
TLQKLDIMKLAVSNTRKYGLCMMLGAQDMPQFLDIYGEYLARTIINGCQTKLLLRVTDAEAAEMFSKIIG
QTEVEEKDESLSFGVNSQRDGFSIAKRRLLRDLALPSQILRLRDMTGYLVYPGEYPIARVKYGFVKPRKN
APAFIKRQAFSELFAPAAGSPATAAASESVVAGPSPDWIAHPEILVAASGGVDPETGEILPPRPGAWRWG
DGNQRGDHA
 
Nucleotide Sequence: 1920 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c65064-63145 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGACGGGAAAAAAGCCAAACGGGCTCTTCCAGGATTTTTCCACCGGCTCGGAAATCTGGACTCACCGTG
TCGCGCTGGTGCTCGTCGCGATCCGAAATATCCTGCTGCTCTCTTTGTTTCTCGGTCTGGCGGCCGGGTT
CATCTACGCCGCATTCTTCGTCGACCGCGACATCTGGCGTCCAGCAGTCGCGAACGTTATCGCGCATCTT
CGGTCGGTCGTCATGATGACGGCGGTACCGATGGAATACGAAGTCAACGGCCAGACCGTGCGACTTCCCG
TCGATCAAGTTGTCGCCCTGACGGACCCAGTGTGGGATGTGGCTTATTTCTTTTTGCGGCGATTCCTGAT
CATTGTCGCAACCGTCACGGCATGTACATGCGTCTCGATCGCTGCCTACTGGTATGAGTTCGGTCGCAGC
ACGATGGCCGACAAGGATCTGCGTGGCGCAACGCTCGTCAACGGGAAGCAACTGGCGAAGATGATTCGGC
AAGACGATATGGAGAGCCCGTATTCGATAGCGGGCGTGCCGATGCTGCGCAACGCGGAGACCCTGCATAC
CCTGGTGGTCGGCGCACAGGGTACGGGTAAGTCTCAGCAGTTCTTCGATCGGCTCAGGCAAGTCCGCGCC
CGTGGGAAGCGCGCGATCGTATACGATCCGTCGGGCGAATTTGCGGAGGAATTTTTCCGGGAAGGCAAGG
ACGTCATGATGAATCCGTTCGACGACCGTTCGCCAAACTGGAACATCAAGTATGAGATCGAGGAGGAGTA
CCACTATGACAGCATGGCAACCGCGCTGATTCCCGATCCGCGCGAAGCCGATCCATTTTGGTCATTGGCG
GGGCGCGAGGTGTTTCGAGATGTCGCGCGTACGTTGCACAGAGAGGGCAATCTGACGAACCGCAATCTTT
ACAATTCGATCGCAATGAGCAACCTCGACGCGATCTACCAGTTGCTGCGCAATACCGCCGGCGCGTCGTA
CGTCGATCCCAAGACCGAGCGCACGGGTATGTCGTTGAAGATGACCGTCCAGAACCAGCTTTCCTCTTTC
AGGTATCTCCGTGATGATGGAAAGCCGTTCTCGATCCGTCAGTGGATTTACAACGAGAGTGATTCGTGGA
TGTTCATCTCGACCCGTGAGGAAATGCTCGAGGCGATCAAGCCAATCATGTCGCTCTGGATCGACATCGC
GATCAAAGCGGTGCTCAACCTCACACCGATTCATCGCGAGCGACTGCACTTCTCGATCGACGAAGTCCCG
ACCCTGCAGAAGCTCGATATCATGAAGCTCGCGGTGAGCAATACGCGGAAGTACGGCTTATGCATGATGC
TCGGTGCGCAGGATATGCCGCAGTTCCTCGACATCTACGGGGAATACCTCGCGCGGACGATTATCAACGG
GTGTCAAACCAAGCTGTTGTTGCGCGTAACCGACGCAGAAGCCGCTGAGATGTTCTCGAAAATCATCGGG
CAGACGGAAGTCGAGGAAAAGGACGAGTCGCTGTCGTTTGGTGTGAACTCTCAGCGGGACGGATTCAGCA
TCGCGAAGCGTCGGCTGCTGCGCGACCTAGCGTTGCCCTCACAGATATTGCGACTGCGGGACATGACAGG
CTATTTGGTCTATCCCGGCGAATACCCGATCGCTCGCGTGAAGTACGGGTTTGTCAAACCGCGGAAAAAC
GCACCTGCTTTTATCAAGCGTCAGGCATTCTCCGAACTATTCGCGCCGGCGGCCGGCTCGCCGGCAACCG
CTGCCGCTTCGGAATCCGTAGTCGCTGGCCCATCACCTGACTGGATCGCGCACCCGGAGATACTCGTCGC
GGCGAGCGGCGGCGTCGATCCGGAAACTGGCGAAATCCTGCCACCCCGCCCGGGCGCCTGGCGCTGGGGC
GACGGCAATCAACGAGGAGACCATGCATGA
 Primer design