SecReT4
Protein ID: 206562197
T4SS name [ID]VirB [208]
Gene symbol-
Locus tagBCAM0331
StrainBurkholderia cenocepacia J2315
Repliconchromosome 2 [GenBank: NC_011001] [Browse all T4SS(s) in this replicon]
Location [Strand]385554..386258 [+]
Productputative type IV secretion system protein VirB8
Component typeVirB8
UniProt IDB4EIS2
KEGG IDbcj:BCAM0331
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.7e-49, Aligned region: 10..220
Protein Sequence: 234 a.a.     [Download]
>gi|206562197|ref|YP_002232960.1| putative type IV secretion system protein VirB8 [Burkholderia cenocepacia J2315]
MNDQSDYRRALDFEASLTALQACSERRAWQVAFAAVIVAIGSAAALAVMTPFYRVVPLPIEVNKLTGEAQ
LIEVLDAKHVPLREIEDKHWVEVYVRARERYDWGLLQMDYDRVLEMSDESVARAYRQIYSGPNALDQQLG
ASVQYRTRIVSTTLVPDEPGHAVVHLERTVRKNGIDTGEPAKRFVITLAFTYRPTVLVRERSAIENPFGF
KVTAYSRDAEDTPPPPQPSAGAGR
 
Nucleotide Sequence: 705 bp     [Download]
>gi|206561868|ref|NC_011001.1|:385554-386258 Burkholderia cenocepacia J2315 chromosome 2, complete sequence
GTGAACGATCAAAGCGATTATCGACGTGCGCTTGATTTTGAGGCGTCGCTCACCGCGTTGCAGGCATGCT
CCGAGCGTCGTGCATGGCAAGTGGCGTTTGCCGCCGTTATTGTTGCGATCGGTTCGGCAGCGGCGCTTGC
CGTGATGACGCCGTTCTATCGCGTGGTGCCATTGCCTATCGAGGTGAACAAACTCACCGGCGAGGCGCAA
CTCATCGAGGTGCTCGACGCAAAACACGTGCCACTGCGTGAGATCGAAGACAAGCACTGGGTCGAAGTCT
ATGTACGGGCTCGCGAGCGCTACGACTGGGGACTGTTGCAAATGGATTACGACCGTGTCCTGGAGATGAG
CGACGAATCGGTCGCGCGCGCGTATCGTCAAATCTACAGTGGTCCGAACGCGTTGGATCAGCAACTGGGC
GCGTCAGTTCAATACCGCACCCGAATAGTATCGACGACGCTCGTGCCCGACGAGCCGGGACATGCTGTCG
TGCATCTCGAGCGCACGGTGCGCAAGAACGGCATCGATACCGGTGAGCCAGCAAAACGTTTTGTGATTAC
GCTCGCCTTTACCTACCGCCCCACGGTGCTGGTGCGGGAACGTTCGGCCATCGAAAATCCATTTGGCTTC
AAGGTGACGGCGTACAGCCGAGATGCGGAGGATACGCCACCTCCTCCACAGCCCAGTGCAGGAGCGGGCC
GATGA
 Primer design