SecReT4
Protein ID: 206562200
T4SS name [ID]VirB [208]
Gene symbol-
Locus tagBCAM0334
StrainBurkholderia cenocepacia J2315
Repliconchromosome 2 [GenBank: NC_011001] [Browse all T4SS(s) in this replicon]
Location [Strand]388346..389443 [+]
Productputative type IV secretion system protein VirB11
Component typeVirB11
UniProt IDB4EIS5
KEGG IDbcj:BCAM0334
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.4e-61, Aligned region: 18..322
Protein Sequence: 365 a.a.     [Download]
>gi|206562200|ref|YP_002232963.1| putative type IV secretion system protein VirB11 [Burkholderia cenocepacia J2315]
MPVLPDDASVTELMRSFAPFLADEAVTELVINRPQRILTETHRGWQAHDLPELDFERLMAFAVAIATLTN
QGVSTEHPLLSALLPDNARLQLVVPPVVPSRTVSVTIRRPSADEKTLECHRADGMFEDTVWRHVSGLGKT
GQALRAVDRMLVEQLEARDFAAFFEGAVRAHRNIVIVGSTGSGKTSFMRSLCRYLGATERIVTIEDVREL
FIRHVENCVHLLYSKGSQGRAHVTPADLIACAMRMRPDRVLLAELRGAEAYDFLKLLTTGHAGSMTSFHA
SSAGIAIERFALMAKEHPEAAAWNIASLKRVLRLTIDVIAHMEAQPVLDSHGVQVGKRWAMTEVWFDPRE
KAAIEFDPTERYCDG
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|206561868|ref|NC_011001.1|:388346-389443 Burkholderia cenocepacia J2315 chromosome 2, complete sequence
ATGCCGGTGTTACCCGATGATGCATCGGTGACGGAGCTGATGCGTTCATTCGCACCGTTTCTCGCTGACG
AAGCCGTAACGGAGCTCGTGATCAACCGACCACAGCGTATTCTGACCGAAACCCATCGGGGGTGGCAGGC
ACACGATTTACCAGAACTCGATTTCGAACGTCTCATGGCGTTCGCCGTGGCGATTGCCACATTGACGAAT
CAGGGTGTCTCGACCGAGCATCCGCTGCTTTCCGCACTGTTACCGGACAACGCGCGTCTCCAACTCGTGG
TGCCGCCCGTGGTGCCGTCGCGGACGGTATCGGTCACGATCAGGCGCCCGAGCGCGGATGAAAAGACGCT
CGAGTGCCATCGCGCCGACGGCATGTTTGAGGATACGGTTTGGCGACACGTAAGCGGTCTAGGCAAGACC
GGCCAAGCGTTGCGCGCAGTCGATCGGATGCTCGTTGAGCAGCTTGAAGCGCGTGATTTTGCCGCCTTCT
TCGAAGGCGCCGTGCGAGCACACCGCAATATTGTCATTGTCGGCAGCACGGGCTCCGGCAAGACGAGCTT
TATGCGCAGCTTGTGCCGATACCTGGGAGCAACCGAGCGCATCGTGACGATCGAAGACGTACGCGAGCTG
TTCATTCGGCATGTCGAAAACTGCGTCCATCTTCTCTATAGCAAAGGTTCGCAGGGGCGCGCACACGTAA
CGCCTGCAGATTTGATTGCCTGCGCCATGCGCATGCGCCCCGATCGGGTGTTGCTTGCCGAGCTCCGAGG
GGCGGAAGCGTACGACTTCCTGAAGCTTTTGACCACGGGGCATGCCGGCTCGATGACGAGTTTTCATGCG
TCCAGTGCGGGCATTGCCATCGAGCGGTTTGCGCTCATGGCAAAGGAGCATCCCGAGGCAGCCGCTTGGA
ACATTGCTTCGCTCAAGCGTGTGCTGCGCTTGACCATCGACGTGATCGCTCACATGGAGGCGCAGCCCGT
ATTGGACTCGCACGGTGTGCAGGTCGGCAAACGCTGGGCGATGACCGAAGTCTGGTTCGACCCGCGCGAG
AAGGCCGCTATCGAGTTTGACCCAACCGAGAGGTACTGCGATGGATGA
 Primer design