SecReT4
Protein ID: 206576185
T4SS name [ID]VirB [391]
Gene symbol-
Locus tagKPK_1779
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T4SS(s) in this replicon]
Location [Strand]1845579..1845719 [-]
Productconjugal transfer protein
Component typeVirB7
UniProt IDB5XPN3
KEGG IDkpe:KPK_1779
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 46 a.a.     [Download]
>gi|206576185|ref|YP_002237626.1| unnamed protein product [Klebsiella pneumoniae 342]
MKFSIFLLMLCALTGCARHQGDLPPVSGEPEPVNSPAIIQELAHHV
 
Nucleotide Sequence: 141 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c1845719-1845579 Klebsiella pneumoniae 342 chromosome, complete genome
ATGAAATTCAGCATCTTCCTTCTGATGCTGTGCGCGCTCACGGGCTGCGCACGGCATCAGGGCGACCTCC
CGCCGGTATCCGGCGAACCCGAGCCGGTGAATTCCCCCGCCATCATTCAGGAGCTGGCTCACCATGTCTA
A
 Primer design