SecReT4
Protein ID: 206577036
T4SS name [ID]VirB [391]
Gene symbolvirB8
Locus tagKPK_1778
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T4SS(s) in this replicon]
Location [Strand]1844903..1845586 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDB5XPN2
KEGG IDkpe:KPK_1778
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-53, Aligned region: 12..223
Protein Sequence: 227 a.a.     [Download]
>gi|206577036|ref|YP_002237625.1| virB8 gene product [Klebsiella pneumoniae 342]
MSNIQNIVNVSRSFESILLEKEERSRKTAWRVAAAGLVLAAMAIAAIIILLPLKTTDTELWSVDKQTGRY
EYMTRVKERDIAAEKALAHSLAAHYVRLREGYNYFSLQRDYDDVQLFNSDSVNRDYLDGFNGDQAPDVIF
NKAEYVVYIDIISNVHAPATGPDNLATLRIKRTIRRVADNSVKTDVWNIRLTYRYVPHRQLTDSQREVNP
LGFIVTSYQRDKELRGE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c1845586-1844903 Klebsiella pneumoniae 342 chromosome, complete genome
ATGTCTAATATTCAGAACATTGTTAATGTTTCCCGCTCTTTTGAATCCATCCTGCTGGAAAAGGAAGAGC
GTTCCCGAAAAACCGCCTGGCGGGTGGCCGCTGCCGGACTGGTTCTGGCCGCAATGGCGATTGCGGCCAT
TATTATTCTGCTGCCGCTGAAAACCACCGACACTGAATTATGGTCAGTGGATAAACAGACCGGTCGCTAT
GAATATATGACCCGCGTGAAGGAGCGGGATATTGCTGCTGAAAAAGCGCTGGCACATTCACTGGCAGCAC
ACTATGTCAGACTTCGCGAGGGATATAATTATTTCTCCCTCCAGCGTGATTATGACGACGTGCAGTTATT
TAACAGCGACAGCGTGAACCGGGACTATCTGGACGGGTTTAACGGCGACCAGGCACCGGACGTGATTTTT
AATAAGGCGGAATATGTCGTTTATATCGACATTATTTCCAATGTGCATGCGCCTGCCACCGGGCCGGATA
ATCTGGCAACACTGCGTATTAAGCGCACAATTCGTCGTGTTGCTGATAATTCCGTGAAAACGGATGTGTG
GAATATCCGCCTCACTTACCGCTACGTCCCGCACCGGCAACTGACCGACAGCCAGCGCGAAGTGAACCCG
CTGGGCTTTATCGTCACCAGCTACCAGCGCGATAAAGAGCTGAGGGGGGAATGA
 Primer design