SecReT4
Protein ID: 206577255
T4SS name [ID]VirB [391]
Gene symbol-
Locus tagKPK_1776
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T4SS(s) in this replicon]
Location [Strand]1842712..1844019 [-]
Productconjugation TrbI-like protein
Component typeVirB10
UniProt IDB5XPN0
KEGG IDkpe:KPK_1776
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 8.6e-52, Aligned region: 238..420
Protein Sequence: 435 a.a.     [Download]
>gi|206577255|ref|YP_002237623.1| unnamed protein product [Klebsiella pneumoniae 342]
MSDKPFPDEPEKTTAEREAEARERARVAKAYQEPEQKTPPGQPEVTRFRKASGRRTLIVSLLSLVLVIAM
ASGGDRLLSALKRGDEKESDTAPPSSSGAVQQERKNLGMDSNPFGLFGPGRQESAGPASQSDTAPPLLPL
EPPALNKAAALADGLNNGSTGSGDNTRTSRSGVRSNTETSGRPSASTAHTSCQSVLASGEDGRLRCPDTT
APAGSNNNDNPGVARVTGVRRLGLDPDLYIPVDRYIPCSMMRRFVSDVGGHISCLINEDVWSASNHVRLI
PAGTVARGFYRTGALQHGRSRMFVLWTELRTPEPGSLQIPLTDTQATGPLGEAGIAGWIDSHFWARFGNA
LMLSTVQDVAAAASDAAPGKDRNTDYTENTRAATAEMAKTTLENSISIPPTMYLNQGDVIGIMTGTDIDF
SSVYQLRLKKKWYER
 
Nucleotide Sequence: 1308 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c1844019-1842712 Klebsiella pneumoniae 342 chromosome, complete genome
ATGAGCGACAAACCATTCCCGGACGAGCCGGAAAAAACCACCGCAGAGCGGGAAGCGGAAGCCCGTGAAC
GCGCCCGCGTGGCGAAGGCATACCAGGAACCGGAGCAGAAAACGCCGCCCGGCCAGCCGGAAGTGACCCG
TTTTCGTAAAGCGTCCGGTCGCCGCACGCTGATCGTCAGCCTGCTGAGTCTGGTGCTGGTGATAGCCATG
GCATCCGGTGGCGATCGTCTTCTCAGCGCCCTGAAAAGGGGTGATGAGAAAGAATCTGACACCGCGCCGC
CCTCTTCCTCTGGGGCGGTGCAGCAGGAGCGTAAGAATCTGGGCATGGACAGTAACCCGTTTGGCCTGTT
CGGGCCAGGGAGGCAGGAAAGCGCAGGCCCTGCCAGTCAGAGCGACACTGCTCCTCCCTTATTACCGCTG
GAGCCACCCGCCCTGAACAAGGCGGCAGCACTGGCCGACGGGCTGAACAACGGCAGTACAGGGTCAGGCG
ACAATACACGCACGTCCCGAAGCGGAGTGCGCAGCAACACGGAAACGTCGGGAAGACCGTCAGCCTCCAC
GGCGCACACATCCTGTCAGTCGGTGCTGGCCAGTGGCGAAGATGGACGCCTGCGCTGCCCGGATACGACA
GCACCGGCAGGCAGCAATAACAACGACAATCCGGGCGTTGCCCGCGTCACCGGTGTCAGACGGCTGGGCC
TTGATCCCGATCTCTATATCCCGGTGGACCGCTATATTCCGTGTTCGATGATGCGGCGCTTCGTATCGGA
TGTTGGCGGCCATATCTCCTGCCTTATCAATGAGGATGTCTGGAGCGCCAGCAACCATGTAAGGCTGATC
CCGGCGGGAACAGTTGCCCGTGGTTTCTACCGCACCGGGGCACTGCAACACGGACGCAGCCGGATGTTTG
TGCTGTGGACGGAGCTGCGCACGCCGGAGCCCGGCAGCCTGCAAATCCCGCTCACCGATACGCAGGCCAC
CGGCCCGCTCGGTGAGGCAGGGATCGCAGGCTGGATCGACAGCCATTTCTGGGCGCGTTTCGGCAATGCC
CTGATGCTCAGTACCGTGCAGGACGTGGCGGCAGCGGCATCAGATGCCGCGCCGGGTAAAGACCGCAATA
CCGACTATACCGAAAACACCCGCGCCGCCACGGCGGAAATGGCGAAAACGACGCTGGAAAACAGCATCAG
TATCCCGCCCACGATGTACCTGAACCAGGGCGACGTGATCGGCATCATGACCGGCACGGATATTGATTTT
TCCTCTGTTTATCAACTACGGCTGAAAAAGAAATGGTATGAGCGCTGA
 Primer design