SecReT4
Protein ID: 206577680
T4SS name [ID]VirB [391]
Gene symbolvirB9
Locus tagKPK_1777
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T4SS(s) in this replicon]
Location [Strand]1844016..1844906 [-]
ProductP-type conjugative transfer protein VirB9
Component typeVirB9
UniProt IDB5XPN1
KEGG IDkpe:KPK_1777
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.6e-52, Aligned region: 30..273
Protein Sequence: 296 a.a.     [Download]
>gi|206577680|ref|YP_002237624.1| virB9 gene product [Klebsiella pneumoniae 342]
MMLKHTLLLSGLMVSCLAWGAATPRGSEYDSRMQNVTYNSQNATVVSTRPGYVTMLVFDDDETVIDAQAG
FPRGWTVTKSDNRVGVSPNPITQPVTDASGNNVSQVFLPTAKDWKTNLFVVTSKRDYSLELNVLDRDSPA
QAFVIRYLYPDELRKKTAAASAARQQHQQEALDRQRIAAAFGKATTPRNWRYTKRVAAGSAFIAPDFTWD
DGRFAYIGFSPTKTLPSVFRVINGQEQAVTPGTIKRGNYTVMVVPASPQLVLRYGTSVVGIENAEFGRIP
LTNSDTVSPSVTLEAK
 
Nucleotide Sequence: 891 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c1844906-1844016 Klebsiella pneumoniae 342 chromosome, complete genome
ATGATGCTGAAACATACCCTGCTCCTCTCTGGCTTAATGGTGTCATGCCTGGCATGGGGCGCAGCGACAC
CGCGCGGCAGCGAGTATGACAGCCGGATGCAGAACGTCACGTACAACAGCCAGAACGCCACGGTCGTCAG
TACCCGCCCCGGCTACGTCACCATGCTGGTGTTTGACGATGATGAAACCGTTATCGATGCGCAGGCGGGT
TTTCCCAGAGGCTGGACCGTGACAAAAAGCGATAACCGGGTGGGCGTCAGCCCGAACCCGATTACCCAGC
CGGTCACGGATGCCAGCGGCAACAACGTCAGCCAGGTGTTTCTGCCGACGGCAAAAGACTGGAAAACCAA
TCTGTTCGTGGTGACCTCGAAGCGCGATTACAGCCTGGAGCTGAACGTGCTGGACCGCGACTCGCCCGCT
CAGGCCTTTGTTATCCGCTACCTCTATCCCGACGAACTGCGAAAAAAGACTGCAGCTGCCAGCGCCGCCC
GTCAGCAACATCAGCAGGAAGCACTGGACCGGCAGCGGATAGCGGCGGCATTCGGGAAGGCCACCACGCC
GCGCAACTGGCGCTATACAAAACGGGTGGCAGCTGGCTCAGCCTTCATCGCCCCGGACTTTACCTGGGAT
GACGGTCGTTTCGCGTATATCGGTTTTTCCCCCACGAAAACCCTGCCTTCTGTCTTCCGGGTGATTAACG
GCCAGGAGCAGGCGGTCACGCCCGGAACGATTAAACGGGGCAACTACACCGTGATGGTGGTTCCGGCATC
GCCGCAGCTGGTTCTGCGTTACGGCACATCAGTGGTGGGGATCGAAAACGCCGAATTCGGGCGTATCCCG
CTGACCAACAGCGACACCGTTTCACCGTCCGTTACGCTGGAGGCAAAATGA
 Primer design