SecReT4
Protein ID: 206577848
T4SS name [ID]VirB [391]
Gene symbolvirB11
Locus tagKPK_1775
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T4SS(s) in this replicon]
Location [Strand]1841703..1842722 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB5XPM9
KEGG IDkpe:KPK_1775
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 9.8e-48, Aligned region: 19..309
Protein Sequence: 339 a.a.     [Download]
>gi|206577848|ref|YP_002237622.1| virB11 gene product [Klebsiella pneumoniae 342]
MSAENLSLDFMKNQLFGDYLPVEGLTEIAINRPGELHTKIKGAWQQRESPVTLRQCYAFAKALASWHDDN
IDDTSPILSATLESGERIQTIIPPACERNTVSITLRKPSFEQKTHQSWIDVGFYQRVAGQEKTESQDDAL
IQLYHSGNIPRFMEKAVEYGKTIFIVGETGSGKTTYMKTLLHYIPWHLRLTTIEDNPEIRFYHHANYVHL
FYPADAGDNAIVTPGRLIRANYRMNPDRILLAEIRGREAWDALKIVGSGHEGLITSMHAGSPEECIEGII
DRCYENPDCRNIPFDVLLRKVLKSIDVIVSIDIHGDVRRMSDIYFKPVHLNSMKEAFKQ
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c1842722-1841703 Klebsiella pneumoniae 342 chromosome, complete genome
ATGAGCGCTGAAAACCTGTCACTGGATTTTATGAAAAATCAGCTGTTCGGTGATTATCTGCCAGTCGAAG
GGCTGACCGAAATCGCGATTAACCGACCGGGGGAACTGCACACCAAAATAAAGGGGGCATGGCAGCAGCG
TGAATCCCCGGTCACGCTGCGTCAGTGTTACGCCTTTGCCAAAGCACTGGCGTCCTGGCATGACGATAAT
ATTGACGATACGTCACCGATACTGTCGGCCACGCTCGAATCCGGCGAGCGTATTCAGACGATTATTCCCC
CGGCCTGTGAGCGTAATACGGTATCCATTACGTTACGCAAACCCTCGTTTGAGCAGAAAACACATCAGTC
ATGGATTGATGTGGGATTTTATCAGCGCGTGGCCGGTCAGGAGAAAACGGAAAGTCAGGATGATGCACTG
ATTCAGTTATATCACAGCGGGAATATTCCCCGCTTTATGGAAAAAGCGGTGGAATATGGCAAAACGATTT
TTATTGTGGGTGAAACCGGCTCCGGTAAAACCACCTATATGAAAACGCTACTGCATTATATTCCGTGGCA
TCTCCGGCTAACCACCATTGAGGATAATCCTGAAATCCGTTTTTATCACCACGCCAATTATGTTCATCTT
TTTTACCCGGCGGATGCCGGGGATAACGCTATTGTCACGCCTGGCAGGCTGATTCGTGCTAATTATCGGA
TGAACCCTGACCGGATATTACTGGCGGAAATTCGTGGGCGTGAAGCGTGGGACGCGCTGAAAATTGTCGG
CTCGGGACATGAAGGACTAATCACCTCCATGCACGCGGGCAGCCCGGAAGAATGTATTGAAGGGATCATT
GACCGCTGCTATGAAAACCCCGACTGCCGGAATATTCCTTTTGATGTGCTGTTACGCAAGGTACTTAAAA
GCATTGATGTCATCGTCAGTATTGACATACACGGCGATGTGCGCCGGATGAGTGATATTTACTTTAAGCC
AGTTCATTTAAACAGCATGAAAGAGGCATTCAAACAATAA
 Primer design