SecReT4
Protein ID: 206578288
T4SS name [ID]VirB [391]
Gene symbol-
Locus tagKPK_1782
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T4SS(s) in this replicon]
Location [Strand]1847187..1847915 [-]
Producttype IV secretion system protein
Component typeVirB5
UniProt IDB5XPN6
KEGG IDkpe:KPK_1782
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 5e-38, Aligned region: 22..225
Protein Sequence: 242 a.a.     [Download]
>gi|206578288|ref|YP_002237629.1| unnamed protein product [Klebsiella pneumoniae 342]
MRTRYTFLALSLFFSTQAASAGIPVFDAVQNTESINQWMQKLQQWEDTVTHYKSELDAYKKQLATATGVR
DIQGFLSDARSLKTDIDNLRKSGISLDDLLTTKNSSYSAELQNLYNKYKSFSVCSEEQEGIKSQALADSC
KQMILNQAMAVENTTGVENRINSTLSDISDLSDRISNAQDSKESQDLANAIATKSVQLNALTNQWEMSVR
QAEERTTLLEQQRQKAFEQQQLTAPVADLNNL
 
Nucleotide Sequence: 729 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c1847915-1847187 Klebsiella pneumoniae 342 chromosome, complete genome
ATGCGTACCAGATATACCTTTCTGGCATTATCGTTATTTTTCTCGACGCAGGCGGCCAGCGCCGGAATAC
CGGTTTTCGACGCCGTGCAGAATACCGAATCCATTAACCAGTGGATGCAGAAATTACAGCAATGGGAGGA
TACGGTTACTCATTATAAAAGCGAACTTGATGCGTATAAAAAACAGTTAGCCACTGCAACCGGCGTGCGG
GATATTCAGGGTTTTCTCAGCGATGCCCGAAGCCTGAAAACCGATATTGATAATCTCCGTAAGAGCGGTA
TTTCACTGGATGATCTGCTGACCACGAAAAACAGTTCATATTCTGCTGAACTGCAAAACCTTTACAATAA
ATACAAATCATTCAGCGTATGCAGCGAGGAACAGGAAGGAATAAAATCTCAGGCCCTGGCCGACAGTTGT
AAACAGATGATCCTCAATCAGGCAATGGCGGTTGAGAATACCACTGGCGTTGAAAACAGGATCAACAGCA
CACTCAGCGATATATCAGACTTATCTGACCGTATATCGAATGCGCAGGACTCGAAAGAGTCTCAGGATCT
GGCTAACGCCATCGCGACGAAAAGCGTACAGTTAAATGCGCTGACGAATCAGTGGGAGATGTCTGTCAGA
CAGGCTGAAGAGCGAACGACATTGCTGGAACAGCAAAGACAGAAAGCCTTTGAACAGCAGCAGCTAACGG
CACCTGTTGCTGACCTTAATAATTTATAA
 Primer design