SecReT4
Protein ID: 206578808
T4SS name [ID]VirB [391]
Gene symbol-
Locus tagKPK_1783
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T4SS(s) in this replicon]
Location [Strand]1847938..1850685 [-]
Producttype IV secretion/conjugal transfer ATPase
Component typeVirB4
UniProt IDB5XPN7
KEGG IDkpe:KPK_1783
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 9.5e-41, Aligned region: 271..472
AAA_10 [PF12846], Evalue: 6.1e-32, Aligned region: 535..834
VirB3 [PF05101], Evalue: 1.6e-12, Aligned region: 3..83
Protein Sequence: 915 a.a.     [Download]
>gi|206578808|ref|YP_002237630.1| unnamed protein product [Klebsiella pneumoniae 342]
MATLNKALTRPAAIMGIPLVPFVLVSGAIVLLAVYVSYYLAVLLIPAWAEMKNKARKDIHYFSLLWLAFK
TRGRLFTNTHFGANALLANQYDNVDVSEFIQKMKLSERITLDKYIPYSSHIHPYVIRNRHRDFVATWELG
GTVFECEDEHHLTLMATHLNNVIRSYEGLPLTFYIHRLREKYHDVFEACSGIPFSDEVTRRYYQPVKEKP
FWRHRLFFTVCYAPFSQIEKKTMKAQPHGKRLAALDDALKIMLEYREALESSLSRYMAMPLGIYEENGRV
YSSQVAFFHRLITGQWQKVAVTRSPFYETLSTPDVFFTTDTGECQTVSGSRFFRSLEIKDYSPETHTGML
DALLYAESEYVLTQSFTCMARDEAQHHIRLAEKRLNSTDDDATSQREELIVLRDLLQSGHVSCGKFHFSL
LISSDSAGQVVKDTNVLAQPFADLGIMTTLSTLSLPAAYLAQLPGVYTLRPRLVAVSSQNFADMACLHNF
HPHKRSGNPWREAVAILTSPGGGGYYLNLHDSQAGRDDTGEKTPGNTAIIGKTGSGKTLLMTIMQQLMQK
YRNPASFAPSATIKRLTTVYFDKDRAAEMAIRQMGGRYFRIRTGEPTGFNPFALEPTRRNISFIKRLVRM
LCRRNGKPLDPRDEERISAAVDTIMLDYPPEYRRYGITRLLEVLPEPPTTDARTNGLRIRLKQWAQGGEF
GWVFDNEADTFTISDVDNFGIDGTEFLDDDDIRGPVTFYLLYRVTSLLDGRRLVMFMDEFWRWLADVEFS
RFSLNMLKVIRKLNGIFVPATQSPDEIVRHPIAPAIIEQCGTQIFLANPKASYADYVEKMKVPESVYDTV
RNLDPGEHYMVILKTPLQAGETRPFVAMAKMDLSGLGKLTRLLSGSEDNLKIFDAIYQDGMRPDEWKETF
LERAI
 
Nucleotide Sequence: 2748 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c1850685-1847938 Klebsiella pneumoniae 342 chromosome, complete genome
ATGGCTACGCTGAATAAAGCACTGACGCGGCCTGCCGCCATTATGGGTATTCCTCTGGTGCCGTTCGTTC
TCGTCAGCGGGGCCATCGTCCTGCTGGCGGTCTATGTCAGCTATTACCTGGCGGTTCTGCTCATTCCTGC
CTGGGCGGAAATGAAAAACAAAGCCCGAAAGGATATTCATTATTTCAGTCTGCTCTGGCTGGCGTTTAAA
ACCCGTGGACGACTTTTCACCAATACCCATTTTGGCGCGAATGCCCTGCTGGCAAACCAGTACGATAACG
TTGATGTCTCGGAGTTTATTCAGAAAATGAAATTAAGCGAGCGTATTACGCTGGATAAATATATTCCGTA
CTCCTCCCATATTCACCCTTACGTCATCAGAAACCGTCACCGTGATTTTGTTGCCACCTGGGAGCTGGGC
GGCACGGTCTTTGAATGTGAAGACGAACATCACCTGACCCTCATGGCTACTCACCTGAATAACGTTATTC
GTTCGTATGAGGGTCTGCCGTTAACATTCTATATTCACCGGCTCCGTGAAAAATACCATGATGTTTTTGA
AGCCTGTTCCGGTATTCCCTTTTCCGATGAGGTAACACGTCGGTATTACCAGCCGGTAAAAGAAAAACCG
TTCTGGCGGCACCGGCTGTTTTTCACCGTCTGCTACGCACCGTTCTCTCAGATTGAGAAGAAAACCATGA
AAGCGCAACCGCACGGTAAACGCCTGGCAGCACTGGATGACGCGCTCAAAATCATGCTGGAATACCGCGA
AGCACTGGAATCTTCATTATCCCGCTATATGGCAATGCCGCTGGGGATATATGAAGAAAACGGGCGGGTA
TATTCCTCGCAAGTGGCGTTCTTCCACCGCCTGATCACCGGCCAGTGGCAGAAAGTGGCCGTAACGCGCT
CGCCGTTTTATGAAACGTTAAGCACGCCGGACGTGTTTTTCACCACCGACACCGGTGAATGCCAGACGGT
CAGCGGTTCCCGCTTCTTCCGCAGCCTTGAGATTAAGGATTATTCCCCGGAAACCCATACTGGTATGCTG
GATGCGCTGCTGTACGCCGAAAGCGAGTATGTTCTGACGCAGTCCTTTACCTGCATGGCACGGGATGAGG
CGCAGCATCATATCCGGCTGGCGGAAAAACGGCTTAACTCCACGGACGACGACGCGACTTCCCAGCGCGA
AGAGCTGATTGTCCTGCGCGACCTGCTCCAGTCCGGGCATGTGTCGTGCGGTAAATTCCACTTTTCCCTG
CTGATCTCCTCAGACAGTGCCGGACAGGTGGTGAAGGACACTAACGTTCTGGCCCAGCCCTTCGCCGATC
TGGGTATTATGACAACGCTCTCCACCCTGTCACTGCCCGCCGCATATCTGGCTCAACTGCCGGGAGTCTA
TACGCTGCGTCCCCGACTGGTAGCCGTCAGCAGCCAGAATTTTGCCGATATGGCCTGCCTGCATAACTTC
CATCCCCACAAACGCAGCGGTAATCCGTGGAGGGAAGCCGTCGCCATCCTCACATCTCCCGGCGGTGGCG
GGTATTACCTCAACCTGCACGACAGCCAGGCAGGGCGGGATGACACCGGTGAGAAAACGCCGGGGAATAC
GGCGATTATCGGGAAAACCGGCTCCGGTAAAACCCTGCTGATGACCATCATGCAACAACTGATGCAGAAG
TACCGTAACCCGGCGTCGTTTGCGCCTTCTGCCACCATCAAACGGCTGACCACGGTGTATTTCGATAAGG
ATCGGGCGGCGGAGATGGCGATCCGCCAGATGGGTGGACGATACTTCCGCATCCGTACCGGCGAGCCCAC
CGGCTTCAACCCGTTTGCACTGGAGCCAACCCGCCGGAACATCAGTTTCATCAAACGGCTGGTGCGCATG
CTGTGCCGCCGCAACGGTAAGCCGCTCGATCCCCGCGATGAGGAGCGGATCAGTGCCGCCGTGGACACCA
TCATGCTGGACTATCCGCCGGAGTACCGCCGGTACGGGATCACCCGGCTGCTGGAAGTGCTGCCGGAGCC
GCCGACCACAGACGCCCGCACCAACGGGCTGCGTATTCGCCTGAAACAGTGGGCGCAGGGGGGCGAGTTC
GGCTGGGTGTTTGATAACGAGGCCGATACATTCACCATCAGCGATGTCGATAACTTTGGTATCGACGGCA
CCGAATTTCTGGATGATGACGATATTCGCGGTCCCGTGACCTTTTACCTGCTGTACCGTGTGACCAGCCT
TCTGGACGGTCGCCGTCTGGTGATGTTTATGGATGAGTTCTGGCGCTGGCTGGCCGATGTCGAATTTTCC
CGCTTCTCCCTCAATATGCTGAAAGTCATCCGAAAGCTGAACGGTATCTTCGTTCCGGCAACACAGTCAC
CGGATGAAATCGTCAGACACCCCATCGCCCCGGCGATTATTGAGCAGTGCGGTACCCAGATTTTCCTCGC
AAATCCGAAAGCCAGCTATGCGGATTACGTGGAGAAAATGAAAGTGCCGGAAAGTGTTTATGACACGGTC
AGAAACCTTGATCCGGGCGAGCATTATATGGTCATCCTGAAAACACCGTTACAGGCCGGAGAAACCCGCC
CGTTTGTGGCAATGGCGAAAATGGATCTGTCCGGACTGGGTAAACTCACCCGGCTTCTCAGCGGCAGTGA
GGACAACCTGAAAATATTCGATGCCATTTATCAGGACGGTATGCGACCTGATGAATGGAAAGAAACCTTC
CTTGAGCGGGCAATCTAA
 Primer design