SecReT4
Protein ID: 206579389
T4SS name [ID]VirB [391]
Gene symbol-
Locus tagKPK_1773
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T4SS(s) in this replicon]
Location [Strand]1838835..1840571 [-]
Producttype IV conjugative transfer system coupling protein TraD
Component typeVirD4
UniProt IDB5XPM7
KEGG IDkpe:KPK_1773
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.9e-12, Aligned region: 338..535
TrwB_AAD_bind [PF10412], Evalue: 9.2e-11, Aligned region: 385..536
AAA_10 [PF12846], Evalue: 1.1e-07, Aligned region: 377..477
TraG-D_C [PF12696], Evalue: 1.9e-07, Aligned region: 399..517
Protein Sequence: 578 a.a.     [Download]
>gi|206579389|ref|YP_002237620.1| unnamed protein product [Klebsiella pneumoniae 342]
MGTHLMQRLNAFSDAFSVFLLWQQHNPVILSIFAGLTLPFIFHLPREERKNAPFWLKSVAGVSTFFLIFG
TLSPLTIQGLSFFFKVLDNNILLRLPLWILTIGFTLAGLAFHITARRLLAGEIDSLKHRMIKKSKLERNV
RTDVREVRDMLPDSIAYNPLDYIDLSNGIFIGLDKDNQPQYITPEEFQTQHADLIGTTGSGKGVSACVLL
YQAILSGEGVFVEDPKNDEWAPHVLREACQKAGKKFVLINLNDLNFQLDLLADISHEQLEELFNAGFSLG
KKGEGADFYRIADRRAARNTAAIYENGITLRDLFNTDFVKSLSKDVPAFYGELEEIALVNSINARNGFSL
KTIFDEGGCCYIIGSMRNQKIISAQRMILTRLIQIAETRDRIKGKPRSVAIFLDELKYHLSRPALEGLGA
ARDKGVHIIMAHQSVKDLYDCPADLEGDAVAGSVIENCKFMLVYRLRDPDTADWVARMTGSILVDDEMRK
VKTDISLTEKMETDRMIRQAERYYIDSNMLLNLPKFVGFVFTQNDLAKATKLFHIPAKKQYIDLFSFEHK
NPPHTEKENQIHKPSINL
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c1840571-1838835 Klebsiella pneumoniae 342 chromosome, complete genome
ATGGGAACTCATCTGATGCAAAGGCTGAATGCCTTTTCGGATGCCTTTTCTGTTTTTCTGCTGTGGCAGC
AACACAACCCGGTAATATTATCCATATTCGCCGGGCTGACGCTGCCATTCATCTTTCATCTGCCACGTGA
AGAAAGAAAAAATGCCCCCTTCTGGTTAAAGTCGGTGGCAGGTGTATCCACCTTCTTTCTCATATTTGGC
ACGCTGTCACCGCTGACTATTCAGGGGCTGAGTTTTTTCTTCAAAGTACTCGACAATAACATTCTGCTCA
GATTACCACTCTGGATACTGACGATCGGATTTACGCTGGCTGGTCTGGCTTTTCATATTACCGCCCGAAG
GCTGCTGGCCGGAGAAATCGACAGCCTCAAACACCGGATGATTAAAAAAAGCAAACTGGAAAGAAATGTC
AGAACAGATGTTCGTGAAGTCAGAGACATGTTACCAGACAGCATTGCGTATAATCCGCTGGATTATATTG
ACCTGAGTAACGGTATTTTTATCGGGCTTGATAAAGACAACCAGCCGCAATATATCACCCCCGAAGAATT
TCAAACTCAACACGCCGATCTTATCGGCACCACAGGTTCTGGTAAAGGTGTCAGTGCCTGTGTTCTGCTT
TATCAGGCGATACTTTCAGGTGAAGGCGTATTTGTCGAAGATCCTAAAAATGATGAGTGGGCACCGCACG
TATTGCGGGAAGCCTGCCAGAAAGCGGGAAAAAAATTCGTCCTCATTAACCTGAATGACCTTAATTTCCA
GCTTGATTTACTGGCTGATATCTCTCATGAACAACTGGAGGAACTGTTTAATGCCGGTTTCAGCCTGGGT
AAAAAAGGCGAAGGCGCTGACTTTTACCGTATCGCCGATCGCCGTGCAGCCAGAAATACGGCAGCTATTT
ATGAAAATGGCATAACGTTACGCGACTTATTCAACACTGACTTTGTGAAATCCCTCAGTAAAGATGTGCC
TGCTTTTTATGGTGAGCTTGAGGAAATCGCTTTAGTTAATTCCATTAATGCCCGCAACGGATTTTCCTTA
AAGACCATTTTTGATGAGGGCGGATGCTGCTACATCATCGGCTCGATGCGTAATCAGAAAATCATATCGG
CTCAGCGAATGATTTTAACCCGCCTGATTCAGATAGCCGAAACCCGTGACCGGATAAAAGGCAAACCTCG
TTCGGTCGCTATTTTCCTGGATGAACTCAAATATCACCTTTCCAGACCCGCACTTGAGGGACTTGGCGCG
GCAAGGGATAAAGGCGTGCATATCATCATGGCGCATCAGTCGGTGAAAGATTTATATGACTGTCCGGCGG
ATCTGGAGGGTGATGCCGTAGCCGGTTCGGTGATTGAGAATTGCAAGTTTATGCTGGTTTATCGCCTTCG
TGATCCGGATACTGCCGACTGGGTCGCCAGAATGACAGGCTCTATACTGGTAGACGATGAAATGAGGAAA
GTTAAAACGGATATATCCCTGACGGAGAAAATGGAAACGGACAGGATGATCCGCCAGGCTGAACGATATT
ATATAGACAGCAACATGTTGCTTAACCTCCCCAAATTTGTTGGTTTTGTTTTTACCCAGAACGATCTGGC
GAAGGCAACCAAACTATTCCACATTCCAGCGAAGAAGCAATATATCGACCTATTTTCATTTGAACATAAA
AACCCTCCGCATACCGAAAAAGAAAATCAGATTCACAAACCCTCCATTAACCTGTGA
 Primer design