SecReT4
Protein ID: 206579750
T4SS name [ID]VirB [391]
Gene symbol-
Locus tagKPK_1784
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T4SS(s) in this replicon]
Location [Strand]1850697..1850969 [-]
Producttype IV secretion system protein
Component typeVirB2
UniProt IDB5XPN8
KEGG IDkpe:KPK_1784
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.9e-16, Aligned region: 8..86
Protein Sequence: 90 a.a.     [Download]
>gi|206579750|ref|YP_002237631.1| unnamed protein product [Klebsiella pneumoniae 342]
MRKRRYYAVVSVLLSSPVLAADSGFNKANETLSNTSTGLLGLAAVTITLATMWVGYKVLFDGKSLHDMRN
VIIGAILIVGASGFGAYWAS
 
Nucleotide Sequence: 273 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c1850969-1850697 Klebsiella pneumoniae 342 chromosome, complete genome
ATGCGTAAACGCCGTTACTACGCTGTTGTTTCCGTGCTGCTGTCTTCCCCGGTGCTGGCGGCGGACAGTG
GTTTTAACAAGGCCAATGAAACACTGAGCAATACCTCGACCGGCCTGCTGGGACTGGCCGCCGTCACCAT
CACGCTGGCGACCATGTGGGTGGGCTACAAGGTGCTGTTCGACGGCAAGAGCCTGCACGACATGCGTAAC
GTCATCATCGGCGCGATCCTGATTGTCGGCGCGTCCGGCTTCGGTGCCTACTGGGCGTCATAA
 Primer design