SecReT4
Protein ID: 206580305
T4SS name [ID]VirB [391]
Gene symbol-
Locus tagKPK_1785
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T4SS(s) in this replicon]
Location [Strand]1850972..1851616 [-]
Producttransglycosylase SLT domain-containing protein
Component typeVirB1
UniProt IDB5XPN9
KEGG IDkpe:KPK_1785
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 2.8e-20, Aligned region: 9..137
Protein Sequence: 214 a.a.     [Download]
>gi|206580305|ref|YP_002237632.1| unnamed protein product [Klebsiella pneumoniae 342]
MLSTTAFLALAVQCAATIHPSTSLDVARVESGFHPYAIAEILPDSQGVISHFPTSLTEAIRLTRQLATQE
RRYSVGLMQITSTNFRHYGVTASDLLNPCINLSVFERILADCYRRGGTLKRALSCYYSGNFETGQRPESA
FNQTSYVQRIGYVVPSTREDRLRDPDRNAQPPVRYPAVVLRGEPAGATAPILTSLHYPDAVIRGAIPVIP
DEEK
 
Nucleotide Sequence: 645 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c1851616-1850972 Klebsiella pneumoniae 342 chromosome, complete genome
ATGCTTTCCACCACTGCCTTTCTGGCACTGGCGGTGCAGTGCGCCGCCACTATTCACCCGTCCACGTCGC
TTGATGTCGCACGGGTAGAATCCGGTTTCCACCCTTACGCCATTGCTGAAATCCTGCCAGACAGTCAGGG
CGTGATTTCACATTTCCCCACGAGTTTGACGGAGGCGATCCGTCTCACCAGACAGCTGGCGACACAGGAG
CGACGCTATTCGGTCGGCCTGATGCAAATCACCAGCACCAATTTCCGCCATTACGGCGTCACGGCCAGCG
ACCTGCTTAACCCTTGCATCAATCTGTCGGTATTTGAGCGCATTCTCGCCGACTGTTACCGGCGCGGCGG
CACCCTGAAACGTGCGCTCAGTTGTTACTATTCCGGCAACTTTGAAACCGGCCAGCGACCGGAATCGGCC
TTTAACCAGACCAGCTACGTGCAGCGCATTGGCTATGTCGTCCCGTCCACCCGGGAAGACCGGCTGCGTG
ACCCTGACCGGAACGCGCAACCGCCTGTCCGCTATCCCGCCGTTGTGCTGCGCGGCGAGCCAGCTGGTGC
CACTGCGCCGATCCTGACTTCCTTGCATTATCCCGATGCCGTCATTCGCGGCGCTATCCCTGTTATCCCT
GATGAGGAGAAATGA
 Primer design