SecReT4
Protein ID: 206580674
T4SS name [ID]VirB [391]
Gene symbol-
Locus tagKPK_1780
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T4SS(s) in this replicon]
Location [Strand]1845809..1846828 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeVirB6
UniProt IDB5XPN4
KEGG IDkpe:KPK_1780
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-44, Aligned region: 40..259
Protein Sequence: 339 a.a.     [Download]
>gi|206580674|ref|YP_002237627.1| unnamed protein product [Klebsiella pneumoniae 342]
MSGGIFVGMDKNIMDGLNAVLEGQSSTYGTMISVIIVSSFTLFILFRGYQTLAGKLRTPVEDVAWDVGRM
LLITTFALNRDGWLDLAVAAIQGLKDGISGDDNIWALLDTVWEKAQALGQKLFNMDTSTYVKLNGGLAEV
LVWGGSIVLLMAATFVNLLAEITILLMTTTAPLFIFCLFYGFLKPMFDNWLKTIFAAILTIMFSALSIRI
AINYLNKILDAATKTSAETNMVTLAAQCLLAGIAAGVVVWFSAKLASALSGAAVQAVLQGAAMSGLSGLA
NKSADLTGPGVKGGARLAAKGGMAVAASTGAGAGKTVSAWQKRAAAIESMKRLHRQRHR
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c1846828-1845809 Klebsiella pneumoniae 342 chromosome, complete genome
ATGTCCGGTGGTATTTTTGTTGGTATGGACAAAAACATCATGGATGGACTGAATGCCGTACTGGAAGGTC
AGTCTTCCACTTACGGCACGATGATCAGCGTCATCATCGTCAGCTCTTTTACCCTGTTTATACTGTTTCG
CGGTTATCAGACGCTGGCTGGCAAACTCCGGACCCCGGTAGAAGATGTCGCCTGGGATGTGGGGCGAATG
TTACTGATCACCACCTTTGCGTTAAACCGGGATGGCTGGCTGGATTTGGCGGTAGCAGCTATCCAGGGAC
TCAAAGACGGTATCAGCGGCGATGATAATATCTGGGCGCTGCTTGATACCGTCTGGGAAAAGGCACAGGC
GCTGGGGCAAAAGTTATTTAATATGGACACCTCAACTTACGTCAAACTGAATGGTGGCCTTGCCGAAGTC
CTGGTATGGGGCGGCTCTATTGTCCTGCTGATGGCAGCCACCTTTGTGAACCTGCTCGCCGAAATCACCA
TCCTGTTAATGACGACCACCGCGCCGCTCTTTATTTTCTGCCTGTTTTACGGTTTTCTTAAACCGATGTT
TGATAACTGGCTGAAAACGATTTTCGCGGCAATATTAACGATCATGTTTTCTGCCTTATCCATCCGTATC
GCCATTAATTACCTGAATAAGATACTGGATGCTGCAACAAAAACATCCGCTGAAACCAATATGGTCACGC
TGGCGGCGCAGTGCCTGCTGGCAGGGATTGCGGCAGGTGTGGTGGTCTGGTTCTCCGCGAAGCTCGCCAG
CGCACTCAGCGGGGCCGCCGTACAGGCGGTGCTGCAGGGGGCAGCCATGAGTGGTCTGAGCGGACTGGCG
AATAAATCCGCCGACCTCACCGGTCCGGGTGTGAAGGGTGGTGCCCGCCTGGCTGCGAAAGGCGGCATGG
CCGTCGCCGCGTCGACCGGCGCAGGCGCGGGTAAAACCGTGAGCGCCTGGCAGAAACGCGCCGCCGCCAT
CGAAAGCATGAAACGCCTGCACCGGCAGCGTCACCGTTAA
 Primer design