SecReT4
Protein ID: 208434444
T4SS name [ID]Cag [39]
Gene symbolcag3
Locus tagHPG27_481
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]514715..516160 [+]
Productcag pathogenicity island protein 3
Component typeCagdelta
UniProt IDB2RGB2, B5Z6P5
KEGG IDhpg:HPG27_481
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 481 a.a.     [Download]
>gi|208434444|ref|YP_002266110.1| cag pathogenicity island protein 3 [Helicobacter pylori G27]
MFRKLATAVSLIGLLTSNTLYAKEISEADKVIKATKETKETKKEVKRLKKEAKQRQQIPDHKKPQYASVD
DTKTQALFDIYDTLNVNDKSFGDWFGNSALKDKTYLYAMDLLDYNNYLSIENPIIKTRAMGTYADLIIIT
GSLEQVNGYYNILKALNKRNAKFVLKINENMPYAQATFLRVPKRSDPNAHTLDKGASIDENKLFEQQKRA
YFNYANDVICRPNDEVCSPLRDEMVAMPTSDSTTQKPNIIAPYSLYRLKEKNNANEAQPSPYATQTAPEN
SKEKLIEELIANSQLIANEEEREKKLLAEKEKQEAELAKYKLKDLENQKKLKALEAELKKKNAKKPRVVE
VPISPKTSNSDETMRVVKEKENYNGLLVDKETTIKRSYEGTLISENSYSKKSPINPNDLRSLEEEIKSYY
IKSNGLCYANGISLYAKIKNDPYKEGMLCGYESVQNLLSPLKDKLKYDKQKLQKALLKDSK
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|208433976|ref|NC_011333.1|:514715-516160 Helicobacter pylori G27 chromosome, complete genome
ATGTTTAGAAAACTAGCAACCGCTGTATCGCTCATAGGCTTACTAACCTCTAACACTCTTTATGCTAAAG
AAATAAGTGAAGCCGATAAGGTCATTAAGGCCACTAAAGAAACTAAAGAGACCAAGAAAGAAGTTAAACG
ACTCAAAAAAGAAGCTAAACAGCGCCAACAGATCCCTGATCATAAGAAACCTCAATATGCCTCTGTTGAT
GACACAAAAACTCAAGCGCTGTTTGATATATACGACACCTTGAATGTGAATGACAAAAGCTTTGGGGATT
GGTTTGGTAATAGCGCTTTGAAAGACAAAACCTATCTCTACGCTATGGATCTATTGGATTACAACAACTA
TTTATCCATAGAAAACCCCATTATCAAAACAAGAGCGATGGGGACTTATGCGGATCTCATCATCATCACA
GGTTCGTTAGAACAAGTCAATGGGTATTACAACATTCTAAAAGCGCTCAACAAACGAAACGCTAAGTTTG
TGTTAAAAATCAATGAGAACATGCCTTATGCCCAAGCGACTTTTTTAAGAGTGCCAAAAAGAAGCGATCC
CAATGCCCACACGCTTGATAAGGGAGCGTCAATTGATGAGAACAAGCTTTTTGAACAACAAAAACGCGCG
TATTTCAACTACGCCAACGATGTGATCTGCAGACCCAATGATGAAGTGTGTTCGCCCCTAAGAGATGAGA
TGGTCGCTATGCCCACTAGCGATAGCACTACTCAAAAACCCAATATCATTGCTCCTTATAGCTTGTATAG
ACTAAAAGAGAAAAATAACGCCAATGAGGCCCAACCATCACCTTATGCCACTCAAACCGCTCCTGAAAAC
AGCAAAGAGAAGCTCATAGAAGAGCTAATCGCTAACTCCCAACTCATAGCCAATGAAGAAGAGAGGGAAA
AGAAACTCTTAGCAGAAAAAGAAAAACAAGAGGCTGAATTGGCTAAATACAAGCTCAAAGACTTAGAAAA
TCAAAAGAAACTAAAAGCTTTAGAAGCAGAGTTGAAAAAGAAAAATGCTAAGAAACCTAGAGTAGTGGAA
GTGCCTATTTCCCCTAAAACAAGTAATTCTGATGAAACAATGAGGGTTGTTAAAGAAAAAGAAAACTATA
ATGGGTTATTAGTGGATAAAGAGACCACGATCAAAAGAAGCTATGAGGGGACTTTGATCAGTGAAAATTC
TTACAGCAAAAAATCTCCTATCAACCCTAATGACTTGAGGAGCTTAGAAGAAGAAATCAAAAGCTACTAT
ATCAAGTCTAACGGCTTGTGTTACGCTAATGGTATCAGCCTCTATGCAAAAATCAAAAACGACCCCTATA
AGGAGGGAATGCTGTGTGGTTATGAGAGCGTTCAAAATCTGCTCTCACCTCTAAAGGACAAGCTCAAATA
CGACAAGCAAAAGTTACAAAAAGCGTTACTGAAAGATTCAAAGTAA
 Primer design