SecReT4
Protein ID: 208434446
T4SS name [ID]Cag [39]
Gene symbolcag5
Locus tagHPG27_483
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]516793..519039 [-]
Productcag pathogenicity island protein 5
Component typeCagbeta
UniProt IDB5Z6P7
KEGG IDhpg:HPG27_483
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.3e-180, Aligned region: 177..713
TraG-D_C [PF12696], Evalue: 7.1e-24, Aligned region: 545..668
TrwB_AAD_bind [PF10412], Evalue: 1.6e-10, Aligned region: 508..672
Protein Sequence: 748 a.a.     [Download]
>gi|208434446|ref|YP_002266112.1| cag pathogenicity island protein 5 [Helicobacter pylori G27]
MEDFLYNTLYFIGDYKLVVIFSFIGLIALFFLYKFIKAQKKAFKDKANQPQKKKNFKEIITDGLKERVKT
FGFWLQAILLLSYSFITSGLFFLILLGNFYDDNRLPESDDDLFDIWVYAIQDFPNYYFKALTFSSLKIYG
FNISLVVYSSILCSYIFITFFVWFLKYLTRTRDIGANKKVDDLFGSASWETEEKMIKAKLITPNNKKRTF
DKREVIVGRRGLGDFIAYAGQAFIGLIAPTRSGKGVGFIMPNMINYPQNIVVFDPKADTMETCGKIREKR
FNQKVFIYEPFSLKTHRFNPFAYVDFGNDVVLTEDILSQIDTRLKGHGMVASGGDFSTQIFGLAKLVFPE
RPNEKDPFFSNQARNLFVINCNIYRDLMWTKKGLEFVKRKKIIMPETPTMFFIGSMASGINLIDEDTNME
KVVSLMEFFGGEEDKSGDNLRALSPATRNMWNNFKTMGGAKETYSSVQGVYTSAFAPYNNAMIRNFTSAN
DFDFRRLRIDEVSIGVIANPKESTIVGPILELFFNVMIYSNLILPIHDPQCKRSCLMLMDEFTLCGYLET
FVKAVGIMAEYNMRPAFVFQSKAQLENDPPLGYGRNGAKTILDNLSLNMYYGINNDNYYEHFEKLSKVLG
KYTRQDVSRSIDDNTGKTNTSISNKERFLMTPDELMTMGDELIILENTLKPIKCHKALYYDDPFFTDELI
KVSPSLSKKYKLGKVPDQTTFYDDLQAAKTRGELSYDKSLVPVGSSEL
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|208433976|ref|NC_011333.1|:c519039-516793 Helicobacter pylori G27 chromosome, complete genome
ATGGAAGACTTTTTGTATAACACCTTATACTTCATAGGGGATTATAAGTTGGTTGTTATTTTTAGTTTCA
TAGGGTTAATAGCGTTATTTTTCCTCTATAAATTCATAAAAGCTCAAAAAAAGGCTTTTAAAGATAAAGC
TAACCAACCTCAAAAGAAAAAAAACTTTAAAGAAATCATTACAGATGGGCTGAAAGAAAGGGTTAAAACC
TTTGGCTTTTGGTTGCAAGCTATACTCTTACTATCCTATTCTTTTATCACATCAGGGTTATTTTTCTTGA
TTCTCTTAGGTAATTTTTATGATGATAATAGATTGCCTGAAAGTGATGATGATCTTTTTGATATATGGGT
CTATGCGATACAAGATTTTCCTAATTACTATTTTAAGGCGCTCACTTTTAGCTCACTCAAGATTTATGGG
TTCAATATATCCTTAGTCGTATATAGTTCTATTTTATGCTCTTATATCTTCATTACCTTTTTTGTGTGGT
TCTTAAAATACTTAACTCGGACTAGAGATATAGGAGCGAATAAAAAAGTTGATGATCTCTTTGGTAGCGC
GAGTTGGGAAACTGAAGAAAAAATGATCAAAGCTAAACTTATCACACCCAATAATAAAAAACGCACCTTT
GACAAACGAGAGGTGATTGTAGGCAGGCGTGGCTTGGGGGATTTTATCGCTTACGCAGGACAGGCATTCA
TTGGCTTGATTGCTCCCACTAGAAGCGGTAAAGGTGTGGGTTTCATCATGCCCAATATGATCAATTATCC
TCAAAATATCGTTGTGTTTGACCCTAAGGCGGACACTATGGAGACTTGCGGAAAAATCAGAGAAAAACGC
TTCAACCAAAAAGTGTTCATCTATGAACCTTTCTCCTTAAAAACACACCGATTTAATCCTTTCGCTTATG
TGGATTTTGGTAATGATGTAGTTTTGACTGAAGACATACTCTCTCAAATTGACACACGCCTAAAAGGGCA
TGGGATGGTGGCTAGTGGAGGGGATTTTTCCACTCAAATCTTTGGATTGGCTAAGCTCGTGTTCCCTGAA
AGACCCAATGAAAAAGATCCTTTTTTTAGCAATCAAGCACGAAATCTTTTTGTCATCAATTGCAACATTT
ACAGGGATCTCATGTGGACTAAAAAGGGGCTTGAGTTTGTCAAAAGAAAAAAAATCATCATGCCTGAAAC
CCCCACGATGTTTTTCATAGGTTCTATGGCGAGCGGTATCAACTTGATTGATGAAGACACAAACATGGAA
AAAGTCGTGTCTCTGATGGAATTTTTTGGAGGTGAAGAAGATAAGAGTGGCGACAATCTAAGAGCGCTTA
GTCCTGCTACTAGAAACATGTGGAATAACTTTAAGACAATGGGTGGCGCTAAAGAAACTTATAGCTCTGT
TCAAGGGGTCTATACATCAGCGTTTGCGCCTTACAATAACGCCATGATCAGGAATTTCACGAGCGCTAAT
GATTTTGATTTCAGGCGTTTAAGGATTGATGAAGTGAGTATTGGCGTGATCGCTAATCCTAAAGAAAGCA
CTATTGTTGGACCGATATTAGAGCTGTTTTTCAATGTGATGATTTATAGCAACCTTATTCTGCCAATCCA
TGATCCACAATGCAAAAGAAGTTGCTTAATGCTTATGGATGAATTCACACTCTGTGGCTATTTAGAGACC
TTTGTTAAAGCGGTAGGGATTATGGCAGAATACAACATGCGCCCCGCTTTTGTGTTTCAAAGTAAGGCAC
AACTAGAGAATGACCCCCCACTTGGTTATGGCAGGAATGGTGCTAAGACTATTTTAGACAACCTTTCTTT
GAATATGTATTATGGGATTAACAACGATAACTACTATGAACATTTTGAAAAACTTTCTAAGGTGTTAGGG
AAATACACAAGGCAAGATGTGAGCCGAAGCATTGATGACAATACAGGTAAGACCAACACTTCTATCAGCA
ACAAAGAGCGGTTTTTGATGACCCCTGATGAATTGATGACTATGGGCGATGAGCTTATCATTCTAGAGAA
TACGCTCAAACCTATCAAGTGCCACAAGGCACTTTACTATGATGATCCCTTTTTCACCGATGAACTCATT
AAGGTGAGTCCAAGTTTGAGCAAGAAATACAAATTGGGGAAAGTGCCTGATCAGACGACTTTTTATGATG
ATTTGCAAGCCGCTAAAACTAGAGGTGAATTGAGTTATGATAAATCTTTAGTGCCTGTGGGTTCAAGCGA
ACTGTGA
 Primer design