SecReT4
Protein ID: 208434449
T4SS name [ID]Cag [39]
Gene symbolcagX
Locus tagHPG27_487
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]526506..528071 [-]
Productcag pathogenicity island protein X
Component typeCagX
UniProt IDB5Z6Q0
KEGG IDhpg:HPG27_487
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.3e-38, Aligned region: 54..168
CagX [PF03524], Evalue: 2.3e-38, Aligned region: 256..489
Protein Sequence: 521 a.a.     [Download]
>gi|208434449|ref|YP_002266115.1| cag pathogenicity island protein X [Helicobacter pylori G27]
MGRALFKKIVGCFCLGYLFLSSVIEAAPDIKNFNRGRVKVVNKKIAYLGDEKPITIWTSLDNVTVIQLEK
DETISYITTGFNKGWSIVPNSNHIFIQPKSVKSNLMFEKEAVNFALMTRDYQEFLKTKKLIVDAPDPKEL
EEQKKALEKEKEAKEQAQKVQKDKREKRKEERAKNRANLENLTNAMSNPQNLSNNKNLSELIKQQRENEL
DQMERLEDMQEQAQANALKQIEELNKKQAEETIKQRAKDKISIKTDKSQKSPEDNSIELSPSDSAWRTNL
VVRTNKALYQFILRIAQKDNFASAYLTVKLEYPQRHEVSSVIEEELKKREEAKRQRELIKQENLNTTAYI
NRVMMASNEQIINKEKIREEKQKIILDQAKALETQYVHNALKRNPVPRNYNYYQAPEKRSKHIMPSEIFD
DGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNLGLRWYRVNEIAEKFKLIKDKALVTVINKG
YGKNPLTKNYNIKNYGELERVIKKLPLVRDK
 
Nucleotide Sequence: 1566 bp     [Download]
>gi|208433976|ref|NC_011333.1|:c528071-526506 Helicobacter pylori G27 chromosome, complete genome
ATGGGGCGGGCATTGTTTAAAAAAATTGTTGGCTGTTTCTGTCTTGGTTATTTATTTTTATCTAGCGTAA
TAGAAGCAGCACCTGACATTAAAAATTTTAATCGTGGTAGGGTGAAAGTGGTGAATAAGAAGATTGCTTA
TTTGGGAGATGAAAAACCTATTACGATTTGGACTTCATTAGACAATGTTACTGTGATCCAACTTGAAAAA
GATGAAACTATTTCTTACATCACAACAGGTTTCAATAAAGGTTGGAGTATTGTGCCTAATTCCAATCATA
TATTCATTCAACCTAAATCGGTAAAAAGTAATCTCATGTTTGAAAAAGAAGCAGTGAATTTTGCCCTAAT
GACAAGAGATTACCAAGAATTTTTAAAAACAAAAAAACTTATCGTAGATGCGCCTGATCCTAAAGAATTA
GAAGAACAAAAAAAAGCTCTAGAAAAAGAAAAAGAAGCTAAAGAACAGGCACAAAAAGTGCAAAAAGATA
AAAGAGAAAAAAGAAAGGAGGAGCGTGCAAAAAATAGAGCCAATTTAGAAAATCTCACTAACGCTATGAG
TAACCCACAAAATTTGAGCAATAACAAAAATCTTAGCGAATTGATCAAGCAACAACGAGAAAATGAATTA
GACCAAATGGAACGACTAGAGGACATGCAAGAACAGGCTCAAGCTAATGCGCTCAAACAAATTGAAGAAC
TCAACAAGAAACAAGCTGAAGAGACAATCAAGCAAAGAGCCAAGGATAAAATCAGTATTAAGACAGATAA
ATCTCAAAAAAGCCCCGAGGATAATTCCATAGAATTATCTCCTAGCGATAGCGCTTGGAGAACCAATCTT
GTTGTGCGAACTAATAAAGCCTTGTATCAATTCATTTTGAGAATAGCTCAAAAAGACAATTTTGCTTCAG
CGTATCTAACAGTTAAATTAGAATACCCACAAAGACACGAAGTCTCTAGCGTTATTGAAGAGGAATTAAA
AAAGAGAGAAGAAGCAAAGAGGCAGAGAGAATTGATCAAGCAAGAAAATCTCAACACTACAGCCTACATC
AATAGAGTAATGATGGCGAGCAATGAACAGATTATCAATAAAGAAAAAATAAGAGAAGAAAAACAAAAAA
TTATCTTAGATCAAGCAAAGGCGCTAGAGACCCAATATGTGCATAATGCGTTAAAAAGAAACCCTGTGCC
TAGAAACTACAATTACTACCAAGCACCTGAAAAACGCTCTAAACATATTATGCCCTCTGAAATTTTTGAT
GATGGCACATTCACTTATTTTGGTTTCAAAAACATCACTCTCCAACCTGCTATTTTTGTGGTTCAACCTG
ATGGGAAATTGAGCATGACTGATGCTGCCATTGATCCTAACATGACCAATTTAGGATTGAGATGGTATAG
AGTTAATGAAATTGCAGAGAAGTTTAAGCTCATTAAAGATAAAGCCCTTGTAACAGTGATCAATAAAGGC
TATGGGAAAAATCCATTGACAAAAAATTACAATATCAAAAATTATGGTGAATTGGAGCGTGTGATTAAAA
AGCTCCCTCTTGTCAGAGATAAATAA
 Primer design