SecReT4
Protein ID: 208434451
T4SS name [ID]Cag [39]
Gene symbolcagV
Locus tagHPG27_489
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]529735..530493 [-]
Productcag pathogenicity island protein V
Component typeCagV
UniProt IDB5Z6Q2
KEGG IDhpg:HPG27_489
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.8e-21, Aligned region: 23..225
Protein Sequence: 252 a.a.     [Download]
>gi|208434451|ref|YP_002266117.1| cag pathogenicity island protein V [Helicobacter pylori G27]
MLGKKNEEVLIDENLVGGVIALDRLAKLNKANRTFKRAFYLSMALNVAAVTSIVMMMPLKKTDIFVYGID
RYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQLMQYCDVSFQTQAMRMFNENI
RQFVDKVRAEAIISSNIQREKVKNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGNSSQENL
IINPFGFKVFDIQITDLQNEQTVSEILRKIKEVESKNKALNK
 
Nucleotide Sequence: 759 bp     [Download]
>gi|208433976|ref|NC_011333.1|:c530493-529735 Helicobacter pylori G27 chromosome, complete genome
ATGTTAGGGAAAAAAAACGAGGAAGTCTTGATTGATGAAAATTTGGTTGGGGGTGTGATAGCCCTTGATA
GATTGGCTAAACTCAATAAGGCCAATAGGACTTTCAAAAGGGCTTTTTATCTCTCTATGGCGCTCAATGT
CGCCGCTGTAACGAGTATTGTGATGATGATGCCTTTGAAGAAAACGGATATATTTGTTTATGGCATTGAT
CGATACACAGGAGAATTTAAAATTGTCAAACGATCCGATGCTAGGCAAATTGTCAATTCTGAAGCTGTTG
TGGATAGCGCAACTTCAAAATTTGTCTCATTGCTGTTTGGTTATAGTAAAAATTCTTTGAGGGATCGCAA
GGATCAACTGATGCAATATTGCGATGTGAGTTTCCAAACCCAAGCAATGAGAATGTTCAATGAAAATATC
AGACAATTCGTGGATAAAGTCCGAGCAGAAGCTATCATTAGCTCTAACATACAAAGAGAAAAAGTCAAAA
ATAGTCCCTTAACGAGATTAACATTTTTCATTACCATCAAAATCACGCCTGATACAATGGAAAATTATGA
ATATATTACTAAAAAACAAGTAACTATTTATTATGATTTTGCTAGAGGTAACTCTTCTCAAGAAAATCTT
ATCATCAATCCTTTTGGCTTCAAAGTGTTTGACATTCAAATCACAGATTTACAAAACGAACAGACGGTAA
GCGAAATTTTGAGAAAGATTAAAGAAGTGGAATCAAAAAATAAGGCATTAAACAAATAA
 Primer design