SecReT4
Protein ID: 208434453
T4SS name [ID]Cag [39]
Gene symbolcagT
Locus tagHPG27_491
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]531553..532395 [+]
Productcag pathogenicity island protein T
Component typeCagT
UniProt IDB5Z6Q4
KEGG IDhpg:HPG27_491
PDB IDNA
Domain hit(s) vs Pfam Cag12 [PF13117], Evalue: 7e-36, Aligned region: 13..123
Protein Sequence: 280 a.a.     [Download]
>gi|208434453|ref|YP_002266119.1| cag pathogenicity island protein T [Helicobacter pylori G27]
MKVRASVLTGATILCLILSACSNYAKKVVKQKNHVYTPVYNELIEKYSEIPLNDKLKDTPFMVQVKLPNY
KDYLLDNKQVVLTFKLVHHSKKITLIGDANKILQYKNYFQANGARSDIDFYLQPTLNQKGVVMIASNYND
NPNSKEKPQTFDVLQGSQPMLGANTKNLHGYDVSGANNKQVINEVAREKAQLEKINQYYKTLLQDKEQEY
TTRKNNQREILETLSNRAGYQMRQNVISSEIFKNGNLNMQAKEEEVREKLQEERENEYLRNQIRSLLSGK
 
Nucleotide Sequence: 843 bp     [Download]
>gi|208433976|ref|NC_011333.1|:531553-532395 Helicobacter pylori G27 chromosome, complete genome
ATGAAAGTGAGAGCAAGTGTTTTAACTGGTGCGACAATTCTGTGCTTAATTTTAAGTGCATGCAGTAATT
ATGCGAAAAAAGTGGTGAAACAAAAGAACCATGTTTATACGCCTGTGTATAATGAACTGATAGAGAAGTA
TAGTGAGATACCCTTAAATGACAAACTCAAAGACACACCATTCATGGTGCAAGTGAAGTTGCCAAATTAC
AAGGATTATTTGTTGGATAATAAACAAGTTGTACTAACTTTCAAACTTGTTCATCATTCTAAAAAGATTA
CGCTCATAGGCGATGCCAATAAGATCCTCCAATACAAGAATTACTTCCAAGCTAACGGGGCAAGATCCGA
CATTGATTTTTACTTGCAACCCACTTTGAATCAAAAGGGTGTGGTGATGATAGCGAGTAACTACAATGAT
AATCCTAACAGCAAAGAAAAACCACAGACCTTTGATGTGTTGCAAGGAAGTCAGCCAATGCTAGGAGCTA
ACACAAAAAACTTGCATGGCTATGATGTGAGTGGAGCAAACAACAAGCAAGTGATCAATGAAGTGGCAAG
AGAAAAAGCTCAGCTAGAAAAAATCAATCAGTATTACAAGACTCTCTTACAAGACAAGGAACAAGAATAT
ACCACTAGGAAAAATAACCAACGAGAAATTTTAGAAACATTGAGTAATCGTGCAGGTTATCAAATGAGGC
AGAATGTGATTAGTTCTGAGATTTTTAAGAATGGCAACTTGAACATGCAAGCCAAAGAGGAAGAAGTTAG
GGAGAAGCTACAAGAAGAAAGAGAGAATGAATACTTGCGCAATCAAATCAGAAGTTTGCTCAGTGGTAAG
TGA
 Primer design