SecReT4
Protein ID: 208434457
T4SS name [ID]Cag [39]
Gene symbolcagM
Locus tagHPG27_495
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]537100..538230 [+]
Productcag pathogenicity island protein M
Component typeCagM
UniProt IDB5Z6Q8, B2RGB1
KEGG IDhpg:HPG27_495
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 376 a.a.     [Download]
>gi|208434457|ref|YP_002266123.1| cag pathogenicity island protein M [Helicobacter pylori G27]
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLEDLIFRKQKIKE
LMDHRAKVLSDLENKYKKEKEALEKETRGKILTAKSKAYGDLEQALKDNPLYKKLLPNPYAYVLNQETFT
KEDKERLSYYYPQVKTSSIFKKTTATTKDKAQALLQMGVFSLDEEQNKKASRLALSYKQAIEEYSNNVSN
LLSRKELDNIDYYLQLERNKFDSKAKDIAQKATNTLIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKNV
KDDVELNTLTKNFTNQKLSFAQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKE
HYKIFNFFKTVVSAYRNNVAKNNPFE
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|208433976|ref|NC_011333.1|:537100-538230 Helicobacter pylori G27 chromosome, complete genome
ATGCTTGCAAAAATCGTTTTTAGCTCATTGGTTGCGTTTGGAGTTTTGTCGGCTAATGTGGAGCAGTTTG
GTTCATTTTTCAACGAGATAAAAAAAGAACAAGAAGAAGTGGCTGCAAAAGAAGACGCTCTTAAGGCTCG
CAAGAAGCTCTTAAACAATACGCATGATTTCTTAGAAGACTTGATTTTTAGAAAACAAAAAATCAAAGAG
CTTATGGATCATAGAGCTAAAGTTCTTTCAGACTTAGAAAACAAATACAAAAAAGAAAAAGAGGCTCTAG
AGAAAGAGACAAGAGGTAAAATCCTTACTGCTAAGTCAAAGGCTTATGGGGATCTAGAGCAAGCCTTAAA
AGATAACCCTCTCTATAAGAAACTTCTCCCTAACCCTTATGCCTATGTTTTAAACCAAGAAACATTCACC
AAAGAAGATAAGGAGCGTTTGAGTTATTACTACCCCCAAGTGAAAACGAGCAGTATTTTTAAAAAAACTA
CCGCTACCACTAAAGATAAGGCTCAGGCTTTGCTTCAAATGGGTGTGTTTTCTTTAGATGAAGAACAAAA
CAAAAAAGCGAGCCGATTAGCTTTATCTTACAAGCAAGCGATTGAAGAATATTCCAATAACGTTTCTAAT
TTATTGAGCAGAAAAGAATTGGATAATATAGATTATTACTTACAGCTTGAAAGAAACAAATTTGACTCCA
AAGCAAAAGATATTGCCCAAAAGGCTACTAACACGCTTATTTTTAACTCGGAACGCTTGGCGTTTAGCAT
GGCGATTGATAAGATCAATGAGAAATACTTAAGGGGCTATGAGGCTTTTTCTAACTTGTTGAAAAATGTC
AAAGATGATGTGGAATTGAATACTCTGACTAAAAACTTCACCAATCAAAAATTGAGTTTCGCTCAAAAAC
AAAAATTGTGTTTGTTGGTTTTAGACAGCTTCAATTTTGATACCCAATCCAAAAAATCTATATTAAAAAA
GACTAATGAATACAATATTTTCGTAGATAGCGATCCTATGATGAGCGACAAAACAACTATGCAAAAAGAA
CACTACAAGATATTTAATTTCTTCAAAACAGTGGTTTCTGCATACCGAAACAATGTTGCCAAGAATAATC
CCTTTGAATAG
 Primer design