SecReT4
Protein ID: 208434458
T4SS name [ID]Cag [39]
Gene symbolcagN
Locus tagHPG27_496
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]538245..539165 [+]
Productcag pathogenicity island protein N
Component typeCagN
UniProt IDB5Z6Q9, Q2PQH0
KEGG IDhpg:HPG27_496
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 306 a.a.     [Download]
>gi|208434458|ref|YP_002266124.1| cag pathogenicity island protein N [Helicobacter pylori G27]
MKSIFKKLGSVALYSLVVYGGLNAINTALLPSEYKELVALGFKKIKTLHQRHDDEEVTEEEKEFATNALR
EKLRNDRARAEQIQKNIEAFEKKNNSSIQKKAAKHKGLQELNEINANPLNGNPNSNSSTETKSNKDDNFD
EMINKVNEAFVKPAAPLVPDEWRTPEIEIIINECIISSNDYDGLRKCLIKDIKDQKILAPLLEKIQEIET
ENNKFSRQHLSGLRLVLNNSNNRTFLIASCAICEKRKKEMEQENNYQDTTNASEFGATDTKENEAKDATF
SNNRSKSELPNSVINQIEQSIAHGKK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|208433976|ref|NC_011333.1|:538245-539165 Helicobacter pylori G27 chromosome, complete genome
TTGAAAAGCATCTTCAAAAAATTAGGCTCTGTCGCTCTTTATTCTTTAGTTGTTTATGGGGGCTTAAACG
CTATCAATACAGCATTATTGCCGAGTGAATACAAAGAATTAGTGGCTTTGGGCTTTAAAAAAATCAAAAC
ACTCCATCAAAGACATGACGACGAAGAAGTTACAGAAGAGGAAAAAGAATTCGCCACTAACGCTTTGAGA
GAAAAATTACGAAATGATAGGGCGAGAGCAGAGCAAATTCAAAAGAATATTGAAGCGTTTGAAAAAAAGA
ACAACTCTTCTATTCAAAAAAAAGCGGCTAAGCACAAAGGATTACAAGAATTAAACGAAATTAACGCTAA
CCCTTTGAATGGCAATCCTAATAGCAATTCTTCCACTGAAACCAAATCTAATAAAGATGATAACTTTGAT
GAGATGATCAATAAGGTGAATGAAGCTTTTGTAAAACCTGCTGCTCCGCTTGTGCCTGATGAGTGGAGAA
CGCCTGAAATTGAAATCATTATCAATGAGTGTATTATTTCAAGCAACGATTACGATGGGTTAAGAAAGTG
TTTGATCAAAGACATCAAGGATCAAAAAATTCTTGCCCCCTTATTAGAAAAAATCCAAGAAATAGAGACA
GAAAATAACAAGTTTTCTAGACAACACTTGAGTGGTTTAAGACTCGTTCTTAATAACAGCAACAATAGAA
CCTTTCTTATAGCTTCGTGTGCTATTTGTGAGAAGAGAAAAAAAGAAATGGAGCAAGAAAATAACTACCA
AGATACTACAAATGCAAGTGAGTTTGGAGCTACTGATACAAAAGAAAATGAAGCAAAAGATGCAACATTC
TCAAACAATCGCTCTAAATCTGAACTGCCCAATAGCGTCATTAATCAAATAGAACAAAGCATCGCTCATG
GAAAAAAATAG
 Primer design