SecReT4
Protein ID: 208434459
T4SS name [ID]Cag [39]
Gene symbolcagL
Locus tagHPG27_497
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]539247..539960 [-]
Productcag pathogenicity island protein L
Component typeCagL
UniProt IDB5Z6R0
KEGG IDhpg:HPG27_497
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|208434459|ref|YP_002266125.1| cag pathogenicity island protein L [Helicobacter pylori G27]
MRTLVKNIISSFLLLSVLMAEDITSGLKQLDSTYKETNQQVLKNLDEIFSTTSPSANNKIGQEDALNIKK
AAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINPLDQNTAEQQCGISDKILVLYCE
GKLKIEQEKQNIRERLETSLKAYQSNIGGTASLIIASQTLVESLKNKNFIKGIRKLMLAHNKVFLNYLEE
LDALERSLEQSKRQYLQERQSSKIIVK
 
Nucleotide Sequence: 714 bp     [Download]
>gi|208433976|ref|NC_011333.1|:c539960-539247 Helicobacter pylori G27 chromosome, complete genome
ATGAGAACACTCGTAAAAAATATCATATCTTCTTTTTTGCTATTGTCTGTTTTGATGGCAGAAGATATAA
CAAGCGGCTTAAAGCAACTTGATAGCACCTACAAAGAGACCAACCAACAAGTGCTAAAAAACCTAGATGA
GATTTTTTCAACCACTAGCCCTAGCGCTAATAATAAAATAGGTCAAGAAGATGCTCTAAACATCAAAAAA
GCGGCCATTGCTTTGAGAGGAGATTTAGCGTTATTGAAAGCCAATTTTGAAGCGAATGAGTTATTTTTCA
TCTCAGAAGATGTGATTTTTAAGACTTATATGTCTAGCCCTGAACTTTTATTAACCTATATGAAAATCAA
TCCCTTAGACCAAAACACTGCTGAGCAGCAATGCGGAATATCCGATAAAATTTTAGTTCTTTATTGTGAG
GGGAAGCTGAAAATCGAGCAAGAAAAACAAAATATAAGAGAGCGTTTAGAAACTTCTCTAAAGGCGTATC
AGAGCAATATTGGAGGTACAGCTTCTTTAATCATTGCTTCACAGACGCTTGTAGAAAGCCTAAAAAATAA
AAATTTCATCAAAGGAATCAGAAAGCTTATGTTAGCTCACAACAAGGTCTTTTTAAATTATTTAGAGGAG
TTGGACGCATTAGAAAGATCCCTAGAACAAAGTAAGCGGCAATACCTACAAGAAAGGCAATCAAGTAAGA
TCATTGTCAAATGA
 Primer design