SecReT4
Protein ID: 208434463
T4SS name [ID]Cag [39]
Gene symbolcagG
Locus tagHPG27_501
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]542241..542669 [-]
Productcag pathogenicity island protein G
Component typeCagG
UniProt IDB5Z6R4
KEGG IDhpg:HPG27_501
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|208434463|ref|YP_002266129.1| cag pathogenicity island protein G [Helicobacter pylori G27]
MKTNFYKIKLLFAWCLIIGMFNAPLNADQNTDIKDISPEDMALNSVGLVSRDQLKIEIPKETLEQKVAVL
NDYNDKNVNIKFDDISLGSFQPNDNLGINAMWGIQNLLMSQMMGDYGPNNPFMYGYAPTYSDSSFLPPIL
GY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|208433976|ref|NC_011333.1|:c542669-542241 Helicobacter pylori G27 chromosome, complete genome
ATGAAAACGAATTTTTATAAAATTAAATTACTATTTGCTTGGTGTCTTATCATTGGCATGTTTAACGCTC
CGCTTAACGCTGACCAAAACACTGATATAAAAGATATTAGTCCTGAAGATATGGCACTAAATAGCGTGGG
GCTTGTTTCTAGAGATCAACTAAAAATAGAGATCCCTAAAGAAACCCTAGAACAAAAAGTGGCCGTACTC
AATGACTATAATGATAAAAATGTTAATATCAAATTTGACGACATAAGTTTAGGGAGTTTTCAACCTAATG
ATAATCTAGGTATCAATGCGATGTGGGGCATTCAAAATCTTCTCATGAGCCAAATGATGGGCGATTACGG
TCCAAACAATCCTTTCATGTATGGTTATGCACCAACATACTCAGATTCATCGTTTTTACCACCGATCTTA
GGGTATTAA
 Primer design