SecReT4
Protein ID: 208434466
T4SS name [ID]Cag [39]
Gene symbolcagD
Locus tagHPG27_504
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]546492..547115 [-]
Productcag pathogenicity island protein D
Component typeCagD
UniProt IDB5Z6R7
KEGG IDhpg:HPG27_504
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 207 a.a.     [Download]
>gi|208434466|ref|YP_002266132.1| cag pathogenicity island protein D [Helicobacter pylori G27]
MINNNSNKKLGGFFLKVLLSLVVFSSYGSANDDNQAKKEAQEKEKNTPNGLVYTNLDFDSFKATIKNLKD
KKVTFKEVNPDIIKDEVFDFVIVNRVLKKIKDLKHYDPIIEKIFDEKGKEMGLNVELQINPEVKDFFTFK
SISTTNKQRCFLSLRGETREILCDDKLYNVLLAVFNSYDPNDLLKHISTVESLKKIFYTITCEAVYL
 
Nucleotide Sequence: 624 bp     [Download]
>gi|208433976|ref|NC_011333.1|:c547115-546492 Helicobacter pylori G27 chromosome, complete genome
TTGATCAACAATAATAGTAATAAAAAACTAGGAGGCTTTTTTTTGAAAGTTCTCTTAAGTCTCGTTGTTT
TCAGTTCGTATGGGTCAGCAAATGACGATAATCAAGCCAAAAAAGAAGCACAAGAAAAAGAAAAAAACAC
TCCCAATGGGCTTGTTTATACGAATTTAGATTTTGATAGTTTTAAAGCGACTATCAAAAATTTGAAAGAC
AAGAAAGTAACTTTCAAAGAAGTCAATCCCGATATTATCAAAGATGAAGTTTTTGACTTCGTGATTGTCA
ATAGAGTCCTTAAAAAAATAAAGGATTTGAAGCATTACGATCCAATCATTGAAAAAATCTTTGATGAAAA
GGGTAAAGAAATGGGATTGAATGTAGAATTGCAGATCAATCCTGAAGTGAAAGACTTTTTTACTTTCAAA
AGCATCAGTACGACCAATAAACAACGCTGCTTTCTGTCATTGCGCGGAGAAACAAGAGAAATTTTATGCG
ATGATAAGCTATACAATGTTTTATTGGCCGTATTCAATTCTTATGATCCTAATGATCTTTTGAAACATAT
TAGCACCGTAGAGTCTCTCAAAAAAATCTTTTATACGATTACATGTGAAGCGGTATATCTATAA
 Primer design