SecReT4
Protein ID: 208434918
T4SS name [ID]VirB [606]
Gene symbolcomB8-2
Locus tagHPG27_965
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]1053564..1054550 [+]
Productcompetence protein
Component typeVirB8
UniProt IDB5Z819
KEGG IDhpg:HPG27_965
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1e-27, Aligned region: 96..287
Protein Sequence: 328 a.a.     [Download]
>gi|208434918|ref|YP_002266584.1| competence protein [Helicobacter pylori G27]
MEKVCMNAWELPKVLEERLKEKYGDDWEKYVKAKAINEEELEEQVKDKAKEQQKIQREKTLSGFLKKVGL
KKRDMLQSTMLFDGVKEADALFQAERKIGDWIFSSAVFFFALALIEAIIIICLLPLKEKVPYLVTFSNAT
QNFAIVQRADKSIRANQALIRQLVASYVNNRENISNIKEQNEIAHETIRLQSAFEVWDFFEKLVSYEHSI
YTNINLTRKISIINIALISKTQANIEISAQLFNKEKLESEKRYRIIMTFEFKPIEIDTKSVPLNPTGFMV
TGYDVTEIAILKDLDEKNKVKDDGVKSRIIHTEKKDPHMSQYKDVKEQ
 
Nucleotide Sequence: 987 bp     [Download]
>gi|208433976|ref|NC_011333.1|:1053564-1054550 Helicobacter pylori G27 chromosome, complete genome
ATGGAAAAAGTTTGCATGAACGCATGGGAGTTGCCTAAGGTTTTGGAAGAAAGATTAAAAGAAAAATATG
GCGATGATTGGGAAAAATATGTTAAGGCTAAAGCAATAAACGAAGAAGAGCTTGAAGAACAAGTCAAAGA
TAAAGCCAAAGAGCAACAAAAGATACAAAGAGAAAAAACACTCAGTGGATTTTTAAAAAAAGTTGGTCTA
AAAAAGCGTGATATGTTACAAAGCACTATGCTGTTTGATGGAGTCAAAGAAGCTGATGCACTTTTTCAAG
CAGAGCGTAAAATTGGCGATTGGATCTTTAGCAGTGCGGTATTCTTTTTTGCTTTAGCTCTTATAGAAGC
CATTATTATTATATGCTTATTGCCGTTAAAAGAAAAAGTGCCTTATTTGGTAACCTTTTCAAACGCTACA
CAAAATTTTGCCATAGTCCAAAGAGCAGACAAGAGTATTCGTGCCAATCAAGCGCTTATAAGACAACTGG
TAGCATCTTATGTCAATAATAGAGAAAATATTTCAAATATAAAAGAGCAAAACGAAATAGCCCACGAAAC
CATTAGATTGCAAAGTGCATTTGAAGTATGGGATTTTTTTGAAAAACTTGTTTCTTATGAACATAGCATT
TACACTAATATCAATCTAACACGAAAAATTAGCATTATCAATATCGCTTTAATTAGTAAAACCCAAGCCA
ATATTGAAATATCCGCACAACTTTTTAATAAAGAAAAGTTAGAAAGCGAAAAGCGTTATAGAATAATTAT
GACCTTTGAATTTAAACCCATTGAAATTGATACAAAATCTGTTCCCTTAAATCCTACAGGCTTTATGGTT
ACAGGTTATGATGTAACTGAAATTGCGATTTTAAAAGACTTGGATGAAAAAAATAAAGTCAAAGATGATG
GTGTGAAATCTAGGATTATCCATACCGAGAAAAAAGACCCTCATATGAGCCAGTATAAAGATGTTAAGGA
ACAATAA
 Primer design