SecReT4
Protein ID: 208434923
T4SS name [ID]VirB [606]
Gene symbol-
Locus tagHPG27_970
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]1058237..1059178 [+]
ProductvirB11-like type IV secretion system ATPase
Component typeVirB11
UniProt IDB5Z824
KEGG IDhpg:HPG27_970
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8e-49, Aligned region: 14..290
Protein Sequence: 313 a.a.     [Download]
>gi|208434923|ref|YP_002266589.1| virB11-like type IV secretion system ATPase [Helicobacter pylori G27]
MISNLLKSYLDDFMPILSQPNLNEVVFNKEKEYFLHRPKEKVRCFNEKFTNDYLLVFCEQLAIFRNQKFT
LKTPKLNTSLPYTQIRINALHPSIIASSNISINIRVPSNFKFEINAFKLSEKCLAKNITYDFLLNLVSTG
KNILISGGTASGKTSFVNSLIENIPKNERVVTIEDSPELKISNEDQVNILVDKSGSGFFTYEDGLNAAMR
MSPDRLLLGEIDTHNTALFLRLANTGHSGMISTLHANSVVDAFIAICQNINLNKGGKPTPKETLLDYFCT
GMDYVIQIKKKGSDRIIDDVLNVKSEFKKELVL
 
Nucleotide Sequence: 942 bp     [Download]
>gi|208433976|ref|NC_011333.1|:1058237-1059178 Helicobacter pylori G27 chromosome, complete genome
ATGATTTCCAATCTTTTAAAAAGTTACCTTGATGACTTTATGCCTATTTTAAGCCAGCCTAATTTAAATG
AAGTGGTTTTTAATAAAGAAAAAGAGTATTTCTTGCACCGCCCAAAGGAAAAAGTGAGATGTTTTAATGA
AAAATTTACTAATGATTATTTGTTAGTTTTTTGTGAGCAATTAGCCATTTTTAGAAACCAAAAATTCACT
CTAAAAACGCCTAAGTTAAACACTTCTTTGCCTTACACGCAAATTAGAATTAACGCATTACACCCTAGCA
TTATTGCTAGTTCTAATATCTCTATCAATATTAGAGTGCCTAGCAATTTCAAGTTTGAAATTAACGCCTT
TAAATTAAGTGAGAAATGTCTGGCTAAAAACATTACCTATGATTTTTTACTTAACTTAGTAAGTACAGGT
AAAAATATTTTAATAAGTGGTGGCACAGCTAGTGGTAAGACTAGCTTTGTTAATTCTTTGATTGAAAATA
TTCCCAAAAACGAAAGGGTGGTTACTATTGAAGATAGTCCTGAGTTGAAAATCAGTAACGAAGACCAAGT
TAATATTTTAGTGGATAAAAGTGGGAGCGGATTTTTTACTTATGAAGATGGCTTAAATGCGGCTATGAGA
ATGTCTCCTGATAGATTATTATTAGGCGAAATTGACACGCATAACACTGCGTTATTTTTGCGTTTAGCAA
ATACTGGGCATAGCGGAATGATAAGCACCTTACATGCTAATAGTGTAGTAGATGCTTTTATAGCTATTTG
TCAGAATATCAACTTGAATAAAGGCGGTAAGCCTACGCCTAAAGAAACGCTTTTAGATTATTTTTGCACT
GGTATGGACTATGTTATCCAAATCAAAAAAAAAGGTAGCGATAGGATAATTGATGATGTTTTAAATGTTA
AAAGCGAATTTAAAAAGGAGTTGGTGTTATGA
 Primer design