SecReT4
Protein ID: 208434927
T4SS name [ID]VirB [606]
Gene symbol-
Locus tagHPG27_974
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]1060476..1062203 [+]
Productcag island DNA transfer protein
Component typeVirD4
UniProt IDB5Z828
KEGG IDhpg:HPG27_974
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-68, Aligned region: 83..565
TrwB_AAD_bind [PF10412], Evalue: 6.4e-30, Aligned region: 323..542
TraG-D_C [PF12696], Evalue: 9.9e-25, Aligned region: 411..531
AAA_10 [PF12846], Evalue: 6.1e-10, Aligned region: 82..173
AAA_10 [PF12846], Evalue: 6.1e-10, Aligned region: 385..487
Protein Sequence: 575 a.a.     [Download]
>gi|208434927|ref|YP_002266593.1| cag island DNA transfer protein [Helicobacter pylori G27]
MREKFKTLRDKFKDKTSNLFHKLNSIQKDYYAKTLPKACKDVFTLGSSKSYPMTLNFNKGFCVGLYKGLN
SLKPTYYDAPLSTLIIAPPGSGKTAAVAVPNLLNVPSSCVVLDIKGELFDLTAGYRQQVLKNKIFVFNPL
GNDNTLKFNPFDKRIVEKLDFNRKRRLVDEVGNTIFAEDGANKDPHWTQQAKNLFVFYALYDLCVHNTST
FFEIASAPIKNYVPLINPQSRFYTELYECQSSDNGFIKENGRYIAKVENGVKKMKPNANVELLWYKQVAE
QVYTDPENPKNYDGSVNHLEKDDQGNIMMKEGMLDPIIRNEANKWAKANDKEFASIKSVYSRFMQVFTSY
QVKSATDSMSFEYEDLRVDNISLYIKIAQTDIDTLAPLIRILLESIAKNLLLKESKKFEERVYLFLDEFV
RFGKLPFLLEMPALSRSYGVVLIFITQSNALIEKYYGREDARIVNSTVAYKVIFKMDDLEYAKQVSEEIG
KMTRKTRSHSTEKGQLITGGTSSIGKEAWDLLSAQDIMNIDKDEVIVLVSGHKAKPLKLKANYYFKNKEL
LSRINWEVKPNKEVF
 
Nucleotide Sequence: 1728 bp     [Download]
>gi|208433976|ref|NC_011333.1|:1060476-1062203 Helicobacter pylori G27 chromosome, complete genome
ATGAGAGAAAAATTCAAAACATTAAGAGATAAATTTAAGGATAAAACCAGCAATTTATTCCATAAGCTTA
ATAGCATTCAAAAAGATTATTACGCTAAAACTCTCCCTAAGGCTTGCAAAGATGTCTTTACGCTAGGTTC
TTCTAAAAGTTATCCTATGACCTTAAATTTTAACAAAGGTTTTTGTGTGGGACTATATAAAGGTTTAAAT
TCGCTTAAGCCTACTTATTATGATGCTCCGCTTTCTACTTTAATTATCGCTCCTCCTGGAAGTGGTAAAA
CCGCAGCTGTGGCTGTGCCTAATCTTTTAAATGTGCCTAGCTCTTGTGTGGTGTTAGATATTAAAGGGGA
GTTGTTTGATTTAACGGCTGGTTACAGACAACAAGTTCTAAAAAATAAAATTTTTGTATTTAATCCCTTA
GGAAATGATAACACGCTTAAATTCAATCCGTTTGATAAACGCATTGTAGAAAAATTAGATTTTAACAGAA
AGCGAAGGCTTGTAGATGAAGTGGGTAATACTATTTTTGCTGAAGATGGGGCAAATAAAGACCCTCATTG
GACACAGCAAGCTAAAAATTTATTTGTCTTTTACGCTCTTTATGATTTGTGTGTGCATAACACTAGCACC
TTTTTTGAAATTGCAAGCGCTCCTATAAAAAATTATGTCCCCTTAATCAATCCACAAAGCCGATTTTACA
CTGAATTATATGAATGTCAAAGTAGCGATAATGGTTTTATTAAAGAGAATGGGCGTTATATAGCTAAAGT
AGAAAATGGCGTTAAAAAAATGAAACCTAATGCCAATGTAGAATTGCTATGGTATAAACAAGTAGCCGAA
CAAGTCTATACTGACCCAGAAAATCCTAAAAATTATGATGGATCTGTGAATCATTTAGAAAAAGACGATC
AAGGCAATATTATGATGAAAGAGGGTATGTTAGATCCTATTATTAGAAACGAAGCGAACAAATGGGCTAA
GGCGAATGATAAAGAGTTTGCGAGCATTAAATCAGTTTATAGCCGTTTTATGCAAGTCTTTACAAGCTAT
CAAGTTAAAAGCGCTACAGATAGCATGAGTTTTGAATACGAGGATTTAAGGGTTGATAATATTTCACTTT
ATATTAAAATCGCTCAAACAGATATTGACACACTCGCACCGCTTATCCGTATCCTTTTGGAAAGTATTGC
TAAAAATCTTTTATTGAAAGAGAGTAAGAAATTTGAAGAAAGGGTTTATCTCTTTTTAGATGAATTTGTG
CGTTTTGGTAAATTGCCTTTTTTATTAGAAATGCCAGCATTAAGTAGGAGCTATGGTGTGGTTTTAATTT
TTATTACGCAATCCAACGCTCTTATTGAAAAATATTATGGTAGAGAAGATGCAAGAATTGTTAATAGCAC
CGTGGCTTACAAAGTAATTTTCAAAATGGATGATTTAGAATACGCTAAACAAGTGAGCGAAGAAATCGGC
AAGATGACCAGAAAAACACGAAGCCACTCTACAGAAAAAGGACAACTCATTACCGGAGGGACTTCTAGTA
TAGGTAAAGAGGCGTGGGACTTATTGAGTGCGCAAGATATTATGAATATTGATAAAGATGAAGTGATCGT
TTTAGTAAGCGGCCATAAGGCTAAACCCTTAAAATTAAAAGCGAATTATTATTTTAAAAATAAAGAATTA
CTCTCTCGTATTAATTGGGAAGTCAAGCCCAATAAAGAAGTGTTTTGA
 Primer design