SecReT4
Protein ID: 209395641
T4SS name [ID]VirB [463]
Gene symbol-
Locus tagECH74115_A0017
StrainEscherichia coli O157:H7 str. EC4115
Repliconplasmid pEC4115 [GenBank: NC_011351] [Browse all T4SS(s) in this replicon]
Location [Strand]11883..13850 [+]
Productconjugal transfer protein TraK
Component typeVirD4
UniProt IDB5Z4X6
KEGG IDecf:ECH74115_A0017
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.7e-87, Aligned region: 101..600
TraG-D_C [PF12696], Evalue: 4.7e-24, Aligned region: 436..560
TrwB_AAD_bind [PF10412], Evalue: 1.6e-17, Aligned region: 229..286
TrwB_AAD_bind [PF10412], Evalue: 1.6e-17, Aligned region: 348..563
Protein Sequence: 655 a.a.     [Download]
>gi|209395641|ref|YP_002268527.1| unnamed protein product [Escherichia coli O157:H7 str. EC4115]
MKKKIILVVFLLLILVACLIGGNYLGGYAALKYSGLSIDMLQWNTFNNVITQFSGKPEYKKLVAITWAGF
AAPCAIFIGFVVIVIAGLMPKKVIYGNARLATDMDLAKSTFFPTDKELKEARLKNSKPYCYPPILIGKQF
KGRFKNKYIYFFGQQFLILYAPTRSGKGVGIVIPNCVNYPDSMVVLDIKLENWFLSSGYRQNVLGQECFL
FAPAGYAENQQEAKKGNIRSHRWNPLDCVNRSDIQRSGDLEKIAAMLIPASDDPIWSDSARKLFCGLALY
LLDKERFHLQQKKKGVADVPDVLVSMSAIMKLSVPESGQKLSAWMGTEIDQKEYLSDETKSLFREFMAAP
EKTQGSIITNFSSPLSIFKNPITAAATDASDFDVRMVRKKPMSIYLGLTPDALITHSRLVNLFFSMLVNE
NTKELPEQNPELKYQCLVLLDEFTSMGKSEIIEKGVGFTAGFNLRFVIILQNEGQGKKDDMYGTHGWETF
VENSAVVLYYPPKAKNELAKKISEEIGVRDMKIIKKSDSRSGGKGGSSRSRNHEIVSRAVLLPEEIVELR
DYKNKMGNMAVREIVMSEYTRPFVANKIIWFEEEEFKKRVDIAKENPVEMPVLFDEEMRNQILEQAKIYS
DDISMFSDVMTKPDLETHDLEDVSE
 
Nucleotide Sequence: 1968 bp     [Download]
>gi|209395638|ref|NC_011351.1|:11883-13850 Escherichia coli O157:H7 str. EC4115 plasmid pEC4115, complete sequence
ATGAAGAAAAAAATCATATTAGTGGTTTTTTTATTGCTTATTCTCGTTGCTTGTCTTATTGGCGGTAATT
ATCTTGGGGGATATGCAGCATTAAAATATTCAGGATTGAGTATTGACATGTTGCAATGGAATACATTTAA
TAATGTTATTACACAATTTAGCGGAAAACCTGAATATAAAAAATTGGTCGCGATTACATGGGCTGGATTT
GCTGCACCATGTGCAATATTTATTGGTTTTGTTGTTATTGTCATAGCCGGACTGATGCCAAAAAAAGTTA
TTTATGGCAATGCTCGTCTTGCTACTGATATGGACCTGGCTAAATCAACCTTTTTCCCAACAGATAAAGA
GTTGAAAGAAGCAAGATTAAAGAACAGTAAACCATACTGCTATCCACCTATTCTTATTGGTAAACAGTTT
AAAGGAAGGTTTAAAAACAAATATATATATTTCTTCGGGCAACAGTTTTTAATCCTTTATGCTCCTACGC
GTTCTGGTAAAGGTGTTGGTATTGTTATACCTAACTGTGTGAATTACCCGGATTCGATGGTTGTTCTTGA
TATAAAACTTGAAAACTGGTTTTTGTCTTCCGGATACAGACAGAATGTGTTAGGGCAGGAATGTTTTCTG
TTTGCTCCTGCGGGATATGCAGAAAACCAGCAGGAGGCGAAAAAAGGTAATATCAGATCACACCGCTGGA
ATCCTCTGGACTGCGTTAATCGTTCTGATATTCAGCGTTCTGGAGATTTGGAAAAAATTGCCGCTATGTT
GATTCCGGCAAGTGATGATCCTATCTGGTCTGATTCTGCACGGAAGCTCTTTTGTGGGCTTGCTTTATAT
CTTCTGGATAAGGAACGATTCCATCTTCAGCAAAAGAAAAAGGGTGTTGCTGATGTACCTGATGTTCTTG
TGTCCATGTCGGCTATTATGAAACTCTCTGTCCCTGAAAGTGGTCAGAAACTATCAGCCTGGATGGGTAC
GGAAATAGATCAGAAAGAATACCTGAGTGATGAAACAAAGAGTCTGTTTCGTGAATTTATGGCAGCGCCG
GAGAAGACACAAGGAAGTATTATTACCAACTTCTCGTCTCCATTGAGTATTTTTAAGAACCCAATCACAG
CAGCAGCTACTGATGCAAGTGATTTTGATGTGCGAATGGTCAGGAAAAAGCCTATGTCGATATATCTTGG
GCTGACTCCTGATGCATTAATTACTCACTCACGGCTTGTGAATCTATTTTTCTCTATGCTAGTGAATGAG
AATACAAAGGAGCTTCCAGAACAGAATCCTGAGTTGAAATATCAGTGTCTTGTCCTTCTTGATGAATTTA
CATCAATGGGTAAGTCCGAAATTATTGAAAAAGGTGTTGGCTTTACCGCTGGTTTTAACCTGCGATTCGT
TATTATTTTGCAGAACGAAGGGCAGGGTAAAAAAGATGATATGTATGGCACTCACGGTTGGGAAACTTTC
GTTGAAAACTCGGCTGTAGTTCTTTATTACCCGCCAAAGGCTAAAAATGAACTGGCGAAAAAGATCTCTG
AGGAAATTGGAGTCAGGGATATGAAAATTATCAAGAAATCTGACTCACGGAGTGGTGGCAAAGGTGGTAG
TTCTCGTTCCCGAAATCATGAAATAGTCAGCCGTGCTGTATTACTGCCAGAAGAGATTGTCGAGCTTCGG
GATTATAAAAATAAAATGGGTAATATGGCTGTTCGTGAAATCGTAATGAGTGAATACACTCGCCCATTTG
TAGCTAACAAAATAATCTGGTTTGAAGAGGAGGAGTTTAAAAAACGAGTAGATATAGCTAAAGAAAATCC
GGTAGAAATGCCTGTATTGTTCGATGAAGAAATGAGAAATCAGATTCTGGAACAGGCAAAAATATATTCA
GATGATATTAGTATGTTTTCTGATGTTATGACTAAACCAGATCTTGAGACACACGATCTGGAGGATGTTT
CTGAATAA
 Primer design