SecReT4
Protein ID: 209395664
T4SS name [ID]VirB [463]
Gene symbolvirB
Locus tagECH74115_A0016
StrainEscherichia coli O157:H7 str. EC4115
Repliconplasmid pEC4115 [GenBank: NC_011351] [Browse all T4SS(s) in this replicon]
Location [Strand]10812..11831 [+]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB5Z4X5
KEGG IDecf:ECH74115_A0016
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.8e-61, Aligned region: 17..315
Protein Sequence: 339 a.a.     [Download]
>gi|209395664|ref|YP_002268526.1| virB gene product [Escherichia coli O157:H7 str. EC4115]
MSEEHIIARQFLVQTGIQELLDMDDVTEIAVNQPGRIWFEGRDGWCFRDTDKVSYKALMGLAYALCNISG
LEDALKPHNPIASVVLPGGERGQIIVPPATEDNCVVLSIRKPSLTRFSLDDYVNSGRFDRVKIAKKHTAV
LTERQKYLFELSRKGDAASIAKFIREAVNDRLNFLIVGGTGSGKTTVGKAIADLFPPERRYATIEDVHEM
TLPNHPNHIHLFYKKGIVDAKSIIEACMRLKPDHIFLAELRGDEAWSYLEALNTGHEGSISTIHANNTYA
SFSRLASIVKQSSVGMTVDMDLIMRTIKTSIDVILFFNHTYMTELYYDPEEKNRLLSTM
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|209395638|ref|NC_011351.1|:10812-11831 Escherichia coli O157:H7 str. EC4115 plasmid pEC4115, complete sequence
ATGAGTGAAGAACATATTATCGCTCGTCAATTTCTGGTGCAAACAGGGATTCAGGAATTACTGGATATGG
ATGATGTTACCGAAATCGCCGTAAATCAGCCTGGCAGGATATGGTTTGAAGGTCGTGATGGTTGGTGCTT
TCGTGATACAGATAAGGTCAGTTATAAGGCATTAATGGGGCTGGCCTATGCGCTGTGTAACATAAGTGGG
CTTGAAGATGCCCTGAAACCACATAACCCGATTGCGTCGGTTGTTCTTCCTGGTGGTGAACGTGGTCAGA
TTATCGTTCCTCCTGCAACTGAGGATAATTGTGTTGTTCTCTCAATTCGTAAACCATCACTAACGCGTTT
TTCACTTGATGATTACGTTAATTCAGGGCGTTTTGACCGAGTTAAAATTGCTAAAAAACACACAGCAGTG
TTAACTGAGCGGCAGAAATATTTATTCGAGTTATCGCGTAAGGGTGATGCCGCAAGTATTGCTAAATTTA
TTCGTGAGGCGGTCAATGATCGCCTGAATTTCCTGATTGTTGGTGGTACTGGTTCAGGCAAAACAACAGT
AGGTAAAGCAATTGCGGATTTGTTTCCTCCAGAACGGCGCTATGCAACAATTGAAGATGTCCACGAGATG
ACGCTCCCGAATCATCCAAACCATATTCACTTGTTTTATAAAAAGGGAATTGTGGATGCCAAGTCGATTA
TTGAAGCCTGTATGCGCCTTAAACCAGATCATATCTTTCTGGCTGAGTTAAGGGGGGATGAAGCATGGAG
TTATCTTGAAGCTCTTAACACAGGGCATGAAGGCTCAATAAGTACGATCCATGCTAACAATACTTATGCG
TCGTTCTCGCGGCTGGCGAGCATTGTTAAACAATCATCTGTTGGTATGACAGTTGATATGGATTTGATTA
TGAGAACGATTAAGACATCTATAGATGTCATATTATTTTTTAACCATACATATATGACGGAACTATATTA
CGACCCCGAAGAAAAAAATCGTCTACTTAGCACAATGTAA
 Primer design