SecReT4
Protein ID: 209395679
T4SS name [ID]VirB [463]
Gene symbol-
Locus tagECH74115_A0013
StrainEscherichia coli O157:H7 str. EC4115
Repliconplasmid pEC4115 [GenBank: NC_011351] [Browse all T4SS(s) in this replicon]
Location [Strand]8167..8904 [+]
Productconjugal transfer protein TraG
Component typeVirB8
UniProt IDB5Z4X2
KEGG IDecf:ECH74115_A0013
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.8e-57, Aligned region: 33..242
Protein Sequence: 245 a.a.     [Download]
>gi|209395679|ref|YP_002268523.1| unnamed protein product [Escherichia coli O157:H7 str. EC4115]
MDLKNKYFGKTKEEAAKKKIDIKKENKQIFDAVKQFERNEIATVQGKAKFITRIAVVLLISNIALAAAIA
FLSPLKTAVPFVIRVDNNTGYTDIAPQLSGAKQTYQEAETKYNLAKFVINYESYDWQTIQEMLDTVNVMS
NNKVFSQYNTAIRADNSPLNVLKDSYKIKTKIKSVTLLKPDVAQVRFSKMILDSSGSLAPEYRVTDWIAT
VAFDFNKDVKTEEQRLINPLGFEAVSYRVDAEAIK
 
Nucleotide Sequence: 738 bp     [Download]
>gi|209395638|ref|NC_011351.1|:8167-8904 Escherichia coli O157:H7 str. EC4115 plasmid pEC4115, complete sequence
ATGGATTTAAAAAATAAATATTTTGGTAAGACAAAAGAAGAAGCGGCTAAGAAAAAAATTGATATAAAGA
AAGAAAACAAGCAAATTTTTGATGCTGTCAAGCAGTTTGAGCGTAATGAAATAGCAACCGTCCAGGGTAA
AGCCAAGTTTATTACGCGAATTGCTGTTGTGCTGTTGATTTCCAATATTGCTCTTGCAGCAGCCATCGCT
TTTTTGTCTCCGTTAAAGACTGCCGTTCCTTTTGTTATTCGTGTGGATAACAATACGGGCTATACAGATA
TTGCACCGCAATTATCAGGAGCAAAGCAAACCTATCAGGAGGCAGAAACAAAATATAATCTTGCGAAGTT
TGTTATTAACTATGAGTCATACGACTGGCAGACTATCCAGGAAATGCTGGATACGGTAAATGTCATGTCT
AATAACAAAGTGTTCTCGCAGTACAATACAGCTATTCGTGCAGATAACTCGCCGCTGAATGTACTGAAAG
ACAGTTATAAGATTAAAACGAAAATTAAGTCTGTTACTTTACTAAAGCCTGATGTTGCGCAGGTCAGATT
CTCAAAAATGATTCTTGACTCTTCCGGCTCTTTGGCTCCCGAATACAGAGTTACAGACTGGATTGCAACG
GTCGCGTTTGATTTTAATAAAGATGTTAAGACGGAAGAACAACGGCTTATTAATCCTCTCGGATTTGAAG
CTGTCAGCTATCGTGTAGACGCGGAGGCTATTAAATGA
 Primer design