SecReT4
Protein ID: 209543129
T4SS name [ID]Trb [258]
Gene symbol-
Locus tagGdia_0959
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_011365] [Browse all T4SS(s) in this replicon]
Location [Strand]1083760..1084761 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB5ZFJ4
KEGG IDgdj:Gdia_0959
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.6e-64, Aligned region: 101..327
Protein Sequence: 333 a.a.     [Download]
>gi|209543129|ref|YP_002275358.1| P-type conjugative transfer protein TrbG [Gluconacetobacter diazotrophicus PAl 5]
MRCFIFAALPVALLSLAGCAQHYHPPVIRYDDAARATKIPDPPKPVQVVEVPKPLPLPGQLKPLPSRRTL
HPAPEVADPTVRVTQANLAARIQPTRAGFINAVQVYPYSPGALYQVYTSPGEITDIMLQQGEKLVGTGPV
AAGDTVRWIIGDTESGAGATKRIHILVKPTRPDLTTNLIVNTDRRTYLAELRSTPATYMASVSWDYPEDD
LIALHRQDSAADDSAPVDVGLDLNALNFRYAIQPVKGATPPWLPGRAFDDGHKVYIAFPAGIGQGELPPL
FVLGADGGPELVNYRVRQNWMIVDRLFAAAELRLGDKHSEQRVRIVRTDGRRT
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|209542188|ref|NC_011365.1|:c1084761-1083760 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGAGGTGCTTCATTTTCGCGGCCCTTCCTGTGGCGCTGCTGTCGCTTGCGGGTTGCGCGCAGCACTACC
ATCCGCCTGTCATCCGTTACGATGACGCCGCGCGCGCAACGAAAATTCCGGACCCACCGAAACCGGTGCA
GGTCGTGGAAGTCCCGAAACCGCTTCCTCTGCCGGGGCAGCTCAAGCCGCTGCCCTCACGACGCACGCTC
CATCCGGCCCCCGAAGTCGCCGATCCCACCGTTCGCGTGACCCAGGCCAATCTGGCGGCGCGCATCCAGC
CGACGCGGGCCGGTTTCATCAATGCGGTGCAGGTCTATCCCTACAGCCCCGGCGCTCTCTATCAGGTCTA
TACCTCGCCGGGTGAAATTACCGACATCATGCTCCAGCAGGGCGAGAAGCTGGTCGGCACCGGGCCGGTT
GCCGCCGGTGATACGGTGCGCTGGATTATCGGTGATACCGAAAGCGGGGCAGGGGCGACAAAACGTATCC
ATATTCTGGTCAAGCCGACGCGGCCGGACCTCACAACCAACCTGATCGTCAACACCGACCGGCGGACCTA
TCTGGCGGAACTGCGCTCCACGCCCGCGACTTACATGGCGTCGGTCTCGTGGGATTACCCCGAGGACGAC
CTGATTGCCCTGCATCGGCAGGACAGTGCGGCCGATGACTCTGCACCGGTGGATGTAGGGCTGGATCTGA
ACGCGCTGAATTTCCGTTACGCCATCCAGCCGGTGAAAGGCGCCACACCGCCCTGGCTGCCTGGCCGGGC
GTTCGATGATGGCCACAAGGTCTACATCGCCTTTCCGGCCGGCATAGGGCAGGGGGAACTGCCGCCGCTC
TTTGTGCTGGGGGCGGATGGTGGCCCGGAACTGGTCAATTACCGGGTGCGGCAGAATTGGATGATCGTGG
ACCGTCTGTTCGCGGCCGCCGAACTGCGGCTGGGTGACAAGCATTCCGAGCAAAGGGTGCGCATCGTCCG
CACTGACGGACGGCGGACATGA
 Primer design