SecReT4
Protein ID: 209543131
T4SS name [ID]Trb [258]
Gene symbol-
Locus tagGdia_0961
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_011365] [Browse all T4SS(s) in this replicon]
Location [Strand]1085447..1086853 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB5ZFJ6
KEGG IDgdj:Gdia_0961
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.1e-45, Aligned region: 40..264
Protein Sequence: 468 a.a.     [Download]
>gi|209543131|ref|YP_002275360.1| conjugal transfer protein TrbL [Gluconacetobacter diazotrophicus PAl 5]
MAMNDVGVIDTFLNTFTTTIDTGFGLVKGNVISLAGTLSVLDIALAGLFWAWAADEDIIQRLVKKTLYIG
FFAWVINDFDALSKIVFDSFAALGLKVGGGSLALGDFLRPGRLASTGFTAAQPLLDSVHNLLGPVAFFTN
FIQIFVLCLSWLIVLAAFFILAVQLFVALIEFKLTTLAGFILIPFALFNRTAFLAEKVLGNVVSSGVKIM
VLAVISAIASVLFAQFTTSYGSDVPTIGQSVSVVLASLSIVGLAIFGGSIANGLISGAPQLGAGAAVGTG
MAVGAMGAAAAAGVGAVASGGAAALGATAAAARGGAAIAGAANTAYSMGAMNAAGGSAGARMAAGLGGVA
RAPGSAAANAVKSKMSSAATAMKQSYGEGARGTFTATGGRFTGGSSSDANGGQAGGPSGNGGGPTGGGEG
GSPDGQSPRWAQKMKRRSAAAHAAEAAHVIRSADGGGGSSSIDLSEKE
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|209542188|ref|NC_011365.1|:c1086853-1085447 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGGCCATGAACGATGTCGGTGTTATCGATACCTTTTTGAACACCTTCACCACCACCATCGATACGGGGT
TCGGTCTGGTGAAGGGGAATGTGATCTCGCTGGCAGGTACGCTGTCGGTGCTGGACATCGCGCTGGCCGG
TCTGTTCTGGGCCTGGGCTGCGGATGAGGACATCATCCAGCGTCTGGTGAAGAAGACGCTCTATATCGGC
TTCTTCGCCTGGGTCATCAACGATTTCGATGCGCTCTCGAAGATTGTTTTTGACAGTTTCGCGGCCCTCG
GTCTGAAGGTCGGAGGCGGCAGTCTGGCTCTCGGTGACTTCCTGCGGCCCGGCCGTCTGGCCTCCACGGG
GTTCACGGCGGCGCAGCCGCTTCTGGACTCTGTTCACAATCTCCTCGGTCCTGTCGCCTTCTTTACGAAT
TTCATCCAGATCTTCGTGCTGTGTCTGTCCTGGCTGATCGTGCTGGCAGCCTTTTTCATCCTCGCCGTGC
AGCTTTTCGTAGCGCTGATTGAGTTCAAGCTGACCACGCTGGCGGGTTTCATCCTGATCCCCTTCGCCCT
GTTCAATCGTACGGCTTTCCTCGCCGAGAAGGTGCTGGGCAATGTCGTCTCCTCGGGTGTGAAGATCATG
GTGCTGGCGGTCATTTCCGCCATCGCATCCGTTCTGTTCGCCCAGTTTACGACGTCCTATGGCAGCGACG
TGCCGACCATCGGGCAGTCCGTCTCGGTGGTGCTGGCGTCTCTGTCGATCGTCGGGCTCGCCATTTTTGG
CGGCAGCATCGCCAACGGGCTGATCTCCGGCGCACCGCAGCTTGGCGCGGGAGCGGCTGTTGGCACCGGC
ATGGCGGTGGGCGCCATGGGCGCTGCTGCTGCGGCCGGTGTCGGCGCTGTCGCCTCTGGCGGTGCCGCTG
CGCTGGGCGCTACAGCCGCCGCCGCGCGGGGAGGGGCCGCGATCGCGGGTGCGGCCAACACGGCTTATTC
CATGGGAGCCATGAATGCTGCCGGGGGCAGTGCCGGTGCCCGTATGGCGGCTGGTCTGGGCGGTGTCGCC
CGGGCGCCGGGCAGTGCTGCCGCAAATGCCGTGAAGAGTAAAATGTCGTCGGCGGCGACCGCCATGAAGC
AGAGCTACGGCGAGGGAGCGCGAGGCACCTTCACCGCGACGGGCGGACGTTTCACGGGTGGGTCGTCGTC
CGATGCGAACGGCGGGCAGGCCGGTGGTCCGTCAGGTAATGGCGGCGGACCAACGGGTGGTGGTGAAGGC
GGCAGTCCCGACGGTCAGTCACCCCGCTGGGCGCAAAAGATGAAGCGCCGCAGTGCCGCCGCCCATGCTG
CTGAGGCCGCGCATGTCATTCGCTCCGCCGACGGCGGGGGCGGATCTTCCTCCATCGATCTGTCGGAAAA
GGAATGA
 Primer design