SecReT4
Protein ID: 209543135
T4SS name [ID]Trb [258]
Gene symbol-
Locus tagGdia_0965
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_011365] [Browse all T4SS(s) in this replicon]
Location [Strand]1090320..1090685 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDB5ZFK0
KEGG IDgdj:Gdia_0965
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-23, Aligned region: 26..111
Protein Sequence: 121 a.a.     [Download]
>gi|209543135|ref|YP_002275364.1| conjugal transfer protein Trbc [Gluconacetobacter diazotrophicus PAl 5]
MPPSRLRAIVCAVARPDRHVPDLRVFGTSMLLSLAFASSAWASGSSMPWETPLNEILESVQGPVAKIISV
IIITVTGLTLAFGETSGGFRRLIQIVFGLSIAFAASSFFLSFFSFSGGALI
 
Nucleotide Sequence: 366 bp     [Download]
>gi|209542188|ref|NC_011365.1|:c1090685-1090320 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGCCGCCTTCACGTCTGCGCGCCATCGTATGCGCTGTCGCACGTCCCGACCGGCATGTGCCGGATCTTC
GTGTGTTCGGAACCTCCATGCTGCTGTCGCTTGCTTTCGCGTCATCGGCATGGGCGTCAGGATCCAGCAT
GCCGTGGGAAACGCCGCTGAACGAGATTCTGGAATCCGTGCAGGGGCCGGTGGCGAAGATCATCTCGGTC
ATCATTATCACCGTGACCGGTCTGACCCTGGCCTTCGGGGAAACATCCGGCGGGTTTCGCCGCCTGATTC
AGATTGTCTTTGGGCTAAGCATCGCTTTTGCGGCGTCGAGCTTCTTTCTGTCGTTCTTCTCCTTCTCCGG
TGGAGCACTGATCTGA
 Primer design