SecReT4
Protein ID: 209543174
T4SS name [ID]Trb [259]
Gene symbol-
Locus tagGdia_1005
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_011365] [Browse all T4SS(s) in this replicon]
Location [Strand]1132545..1133531 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB5ZFY6
KEGG IDgdj:Gdia_1005
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.4e-67, Aligned region: 99..321
Protein Sequence: 328 a.a.     [Download]
>gi|209543174|ref|YP_002275403.1| P-type conjugative transfer protein TrbG [Gluconacetobacter diazotrophicus PAl 5]
MRTLNTVASLMILLAPLAACSSWKPPAIRYDDTPRQAVLTPEPPKPVQVVTLPEPLPLPGQLKPIPYRHA
APEAADPHQRVEHANSAARVQPTRAGYLNAIQVYPFSEGALYQLYAAPGEITDIALQPGEKLVGSGPVAA
GDTVRWIIGDTESGAGASKRIHILLKPTRPDLITNLVINTDRRTYHLELRSDERTYMASVSWDYPQDQIV
ALRGQDRDSDLGTPVATGVDLDALNFRYRIEGDEVPWRPLRAFDDGRQVFIEFPTGIAQGEMPPLWVIGP
QGDGQLVNYRVRGNRMIVDRLFAAAELRLGAKHQQVVRIVRTDGARRS
 
Nucleotide Sequence: 987 bp     [Download]
>gi|209542188|ref|NC_011365.1|:c1133531-1132545 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGCGCACCCTCAATACCGTCGCGTCGCTCATGATCCTGCTGGCGCCGCTCGCGGCCTGCTCATCATGGA
AGCCGCCTGCCATCAGATACGACGATACGCCCCGGCAGGCGGTTCTTACGCCTGAGCCACCGAAGCCGGT
GCAGGTGGTGACACTGCCCGAGCCGCTGCCGTTGCCGGGACAGCTCAAGCCGATTCCCTACCGGCATGCG
GCACCGGAAGCTGCTGATCCCCATCAGCGGGTCGAGCATGCCAATAGTGCGGCGCGGGTCCAGCCGACGC
GGGCCGGTTATCTCAATGCGATCCAGGTCTATCCCTTCTCCGAGGGCGCGCTCTATCAGCTCTACGCCGC
ACCCGGCGAGATCACCGACATCGCGCTGCAGCCGGGCGAGAAGCTGGTCGGCTCCGGTCCGGTCGCCGCC
GGCGATACCGTGCGCTGGATCATCGGCGATACCGAGAGCGGGGCAGGGGCGTCGAAACGGATTCATATCC
TGCTCAAACCGACGCGCCCGGATCTGATCACCAATCTGGTCATCAATACCGACCGGCGCACCTACCATCT
GGAGCTGCGCTCCGACGAGCGGACCTATATGGCCTCGGTGTCCTGGGACTATCCGCAGGACCAGATCGTT
GCCCTGCGCGGGCAGGATCGGGATTCTGATCTTGGCACTCCGGTCGCGACGGGCGTCGATCTCGACGCGC
TGAATTTCCGCTATCGGATCGAGGGCGACGAGGTGCCATGGCGGCCGTTGCGGGCCTTCGATGACGGGCG
GCAGGTCTTCATCGAGTTTCCGACCGGCATCGCCCAGGGGGAAATGCCGCCGTTGTGGGTCATCGGCCCG
CAAGGGGACGGCCAGTTGGTGAATTACCGGGTTCGCGGCAACCGGATGATCGTCGATCGCCTGTTCGCGG
CAGCCGAATTGCGACTGGGGGCGAAGCACCAGCAGGTGGTGCGCATCGTGCGCACCGATGGAGCCCGTCG
GTCGTGA
 Primer design