SecReT4
Protein ID: 209543176
T4SS name [ID]Trb [259]
Gene symbol-
Locus tagGdia_1007
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_011365] [Browse all T4SS(s) in this replicon]
Location [Strand]1134214..1135473 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB5ZFY8
KEGG IDgdj:Gdia_1007
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.2e-48, Aligned region: 38..262
Protein Sequence: 419 a.a.     [Download]
>gi|209543176|ref|YP_002275405.1| conjugal transfer protein TrbL [Gluconacetobacter diazotrophicus PAl 5]
MQQGTGVIDNFLAIFTQYIDSGFGLVQGDVHWLAGVLITIDITLAGLFWALAPDEDVLARLVRKTLFIGM
FAFIIGNFNGLARIIYESFAGLGIEAGGGHLTQAQLLQPGRLAQVGIDAGKPILTSISSLVGFVAIFNNA
IQIVVLLLAWLIVVISFFVMAIQLFVALIEFKLTTLAGFVLVPFGLFGRTAFLAEKVLGNVVSSGIKVLM
LAVIVGIGSTVFGQFTSGFNNPPTINDALTLILASLTLLGLTVFGPALANGLIAGGPQLGAGSAVATAAG
VVGAGVAAASGAGLAVGAAAAAVRGGAFVAGGTTAAYQAGGAVGVAKAGLSAAASPLRRAMASVRTSYQV
GGAAATGGAGGATASGAGGGAGTAGKPPAWASRMQRNNRIKGGAEAAAQAIKGGDRPSGGHDVDLSEGE
 
Nucleotide Sequence: 1260 bp     [Download]
>gi|209542188|ref|NC_011365.1|:c1135473-1134214 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGCAGCAGGGCACCGGCGTCATCGACAATTTCCTTGCCATCTTCACCCAGTATATCGATTCCGGCTTCG
GGCTGGTGCAGGGCGACGTCCACTGGCTCGCCGGTGTGCTGATCACCATCGACATCACCCTGGCCGGGCT
GTTCTGGGCGCTGGCGCCGGATGAGGACGTGCTGGCGCGGCTGGTCCGCAAGACCCTGTTCATCGGTATG
TTTGCCTTCATCATCGGGAATTTTAACGGTCTCGCCCGCATCATCTATGAATCCTTCGCAGGCCTCGGCA
TCGAGGCTGGTGGTGGCCATCTCACCCAGGCGCAGCTTCTCCAGCCGGGGCGGCTGGCGCAGGTTGGCAT
CGATGCCGGCAAGCCGATCCTGACCTCGATTTCCTCGCTGGTCGGTTTCGTCGCCATCTTCAACAACGCA
ATCCAGATCGTGGTGCTGCTGCTCGCCTGGCTGATCGTGGTCATCAGCTTCTTTGTCATGGCGATCCAGC
TTTTCGTGGCGCTGATCGAGTTCAAGCTGACCACGCTCGCCGGGTTCGTGCTGGTGCCCTTCGGACTATT
CGGCCGCACCGCCTTCCTCGCCGAGAAGGTGCTGGGCAATGTGGTGTCGTCCGGGATCAAGGTGCTGATG
CTGGCCGTCATCGTCGGTATCGGTTCGACAGTGTTCGGCCAGTTCACCAGCGGCTTCAATAATCCGCCCA
CCATCAACGACGCGCTGACCCTGATCCTCGCCTCCCTGACGCTGCTGGGGCTGACCGTGTTCGGCCCGGC
ATTGGCCAACGGGCTGATCGCCGGTGGCCCGCAACTCGGCGCGGGATCCGCTGTCGCTACAGCCGCCGGG
GTCGTTGGTGCCGGCGTGGCCGCCGCATCCGGGGCTGGACTGGCCGTGGGGGCCGCTGCAGCCGCAGTGC
GTGGCGGGGCCTTTGTCGCGGGCGGCACGACCGCCGCCTATCAGGCCGGAGGTGCGGTCGGTGTTGCGAA
AGCCGGACTGTCCGCCGCCGCCAGCCCGTTGCGCCGGGCCATGGCCAGTGTCCGCACCAGCTATCAGGTT
GGCGGAGCGGCTGCGACTGGCGGGGCGGGTGGTGCGACCGCTTCTGGTGCTGGCGGTGGCGCGGGTACGG
CCGGCAAGCCGCCCGCCTGGGCCAGCCGGATGCAGCGCAACAACCGGATCAAGGGTGGGGCTGAGGCGGC
CGCACAGGCGATCAAGGGCGGCGACCGGCCCAGTGGTGGCCATGACGTCGATCTCTCGGAAGGAGAATAG
 Primer design