SecReT4
Protein ID: 209543181
T4SS name [ID]Trb [259]
Gene symbol-
Locus tagGdia_1012
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_011365] [Browse all T4SS(s) in this replicon]
Location [Strand]1139193..1139519 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDB5ZFZ3
KEGG IDgdj:Gdia_1012
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.2e-24, Aligned region: 8..98
Protein Sequence: 108 a.a.     [Download]
>gi|209543181|ref|YP_002275410.1| conjugal transfer protein Trbc [Gluconacetobacter diazotrophicus PAl 5]
MTRMIVLRRHLEVAGATLSLALLSAPAYAAGSNMPWEEPLNQILESVQGPVARIVSVIIITVTGLTLAFG
ETSGGFRRLVQIVFGLSIAFAASSFFLSFFSFAGGALT
 
Nucleotide Sequence: 327 bp     [Download]
>gi|209542188|ref|NC_011365.1|:c1139519-1139193 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGACCCGCATGATCGTCCTGCGCCGCCATCTCGAAGTGGCTGGTGCCACCCTGTCGCTCGCCCTGCTGT
CGGCCCCGGCTTACGCGGCAGGCTCCAACATGCCCTGGGAGGAGCCGCTCAACCAGATCCTGGAATCCGT
GCAGGGGCCAGTGGCGCGTATCGTGTCGGTGATCATCATTACCGTAACCGGCCTGACCCTGGCCTTCGGG
GAAACCTCGGGCGGGTTCCGTCGCCTGGTGCAGATCGTCTTCGGCCTGTCGATCGCTTTTGCGGCGTCCA
GCTTCTTCCTGTCCTTCTTCTCCTTTGCGGGCGGGGCGCTGACCTGA
 Primer design