SecReT4
Protein ID: 209544943
T4SS name [ID]Trb [260]
Gene symbol-
Locus tagGdia_2825
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_011365] [Browse all T4SS(s) in this replicon]
Location [Strand]3090201..3090542 [+]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDB5ZHS9
KEGG IDgdj:Gdia_2825
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.6e-23, Aligned region: 11..103
Protein Sequence: 113 a.a.     [Download]
>gi|209544943|ref|YP_002277172.1| conjugal transfer protein Trbc [Gluconacetobacter diazotrophicus PAl 5]
MIRVLATARRMHRRALDVITFAALSLAFAPAAYASGSSMPWETPLNSILESVQGPVAKIISVIIITVTGL
TLAFGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFSGGALI
 
Nucleotide Sequence: 342 bp     [Download]
>gi|209542188|ref|NC_011365.1|:3090201-3090542 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGATCCGTGTTCTCGCCACCGCCCGCCGGATGCACCGGCGCGCCCTCGACGTCATCACCTTCGCTGCGC
TCTCGCTGGCCTTCGCTCCGGCGGCCTATGCCTCTGGCTCCTCCATGCCGTGGGAGACGCCGCTCAACTC
CATCCTGGAGTCGGTGCAAGGCCCGGTCGCGAAGATCATCTCGGTGATCATCATCACGGTGACCGGCCTG
ACCCTCGCCTTCGGCGACACCTCCGGCGGCTTCCGCCGGCTGATCCAGATCGTGTTCGGCCTCTCGATCG
CCTTCGCCGCGTCGAGCTTCTTCCTGTCCTTCTTCAGCTTCTCCGGCGGAGCGCTGATCTGA
 Primer design