SecReT4
Protein ID: 209544948
T4SS name [ID]Trb [260]
Gene symbol-
Locus tagGdia_2830
StrainGluconacetobacter diazotrophicus PAl 5
Repliconchromosome [GenBank: NC_011365] [Browse all T4SS(s) in this replicon]
Location [Strand]3094333..3095697 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB5ZHT4
KEGG IDgdj:Gdia_2830
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-54, Aligned region: 37..262
Protein Sequence: 454 a.a.     [Download]
>gi|209544948|ref|YP_002277177.1| conjugal transfer protein TrbL [Gluconacetobacter diazotrophicus PAl 5]
MNNVGVIDTFLNTFTTYIDSGFGLIKGEVGYLSSTLIVIDITLAGLFWAWGADEDILQRLVKKTLYIGFF
AFIITNFNNLSAIVFNSFAGLGLKAGGSSISTADFLRPGKLAQVGLDAGQPLLDAASQMMGFTSFFANFV
QIAVLMVSWLLVLIAFFILAVQLFVTLIEFKLTTLAGFILIPFALFNKTAFLAEKVLGNIVASGVKVMVL
AVIVGIGTGLFSQFTQTYAGGQPTIEQALSVVLAALAMLGLGIFGPGIATGLVSGAPQLGAGAAVGTGLA
VAGTAMAGAGALGLAGRGAMAAASGTAAAARGGAAMAGGASSAYSVASAGRSGVSGVAAGLGGVGRAAAS
SAVAPIRRAAGRAAGSMRESFAAGARSSFAATGGSSTQGTVGGAQTAGGSGATDAGSNPSGPPAWARRMK
QNQSMARGAQTAAQVLKSGDSHGGGHSVDLSGGE
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|209542188|ref|NC_011365.1|:3094333-3095697 Gluconacetobacter diazotrophicus PAl 5 chromosome, complete genome
ATGAACAACGTCGGCGTCATCGATACCTTTCTCAACACCTTCACCACCTACATCGATTCCGGATTCGGGC
TAATCAAGGGCGAGGTCGGCTATCTTTCCTCCACCCTGATCGTCATCGACATCACGCTCGCCGGTCTATT
CTGGGCCTGGGGCGCCGACGAGGACATCCTCCAGCGCCTGGTCAAGAAGACACTCTACATCGGCTTCTTC
GCCTTCATCATCACCAACTTCAATAATCTCTCGGCCATCGTCTTCAACAGCTTCGCCGGCCTCGGTCTGA
AGGCGGGCGGTTCGTCGATCTCGACCGCCGACTTCCTGCGGCCGGGCAAACTCGCCCAGGTCGGGCTCGA
CGCCGGTCAGCCGCTGCTCGACGCCGCCAGCCAGATGATGGGTTTCACCAGCTTCTTCGCGAACTTCGTG
CAGATCGCGGTGCTGATGGTCTCCTGGCTGCTGGTGCTGATCGCCTTCTTCATCCTCGCGGTGCAGCTCT
TCGTCACGCTGATCGAGTTCAAGCTGACGACCCTCGCCGGCTTCATCCTCATTCCCTTCGCGCTCTTCAA
CAAGACCGCGTTTCTCGCCGAGAAGGTGCTTGGCAACATCGTGGCCTCCGGCGTGAAGGTGATGGTGCTG
GCCGTCATCGTCGGCATCGGCACCGGGCTCTTCTCGCAGTTCACCCAAACCTATGCCGGCGGCCAGCCGA
CGATCGAGCAGGCGCTCTCCGTCGTGCTCGCGGCGCTCGCCATGCTCGGCCTCGGCATCTTTGGCCCAGG
CATCGCTACGGGCCTGGTCTCCGGCGCGCCGCAGCTCGGTGCGGGTGCCGCGGTCGGGACTGGCCTTGCC
GTCGCCGGCACGGCGATGGCCGGCGCCGGAGCGCTCGGCCTGGCCGGAAGGGGAGCGATGGCGGCAGCCT
CGGGCACGGCCGCCGCCGCCCGTGGCGGCGCGGCGATGGCTGGCGGCGCTTCCTCCGCCTACAGCGTGGC
CTCGGCCGGCCGCTCCGGCGTCTCGGGCGTGGCCGCCGGTCTTGGCGGGGTCGGCCGGGCCGCCGCGTCT
TCAGCGGTAGCGCCTATTCGCCGTGCGGCGGGCCGCGCCGCCGGCTCGATGCGCGAAAGCTTCGCCGCCG
GCGCCCGGTCCAGTTTCGCTGCAACCGGCGGCTCATCCACCCAAGGCACGGTCGGCGGCGCGCAGACTGC
GGGCGGCAGCGGCGCGACCGATGCCGGCTCGAACCCGTCGGGGCCGCCCGCCTGGGCCCGTCGCATGAAG
CAGAACCAGTCGATGGCGCGCGGCGCGCAGACCGCCGCCCAGGTTCTCAAGTCCGGCGATAGCCATGGCG
GCGGCCATTCCGTCGATCTCTCGGGAGGAGAATGA
 Primer design